KEGG   Parachlamydia acanthamoebae: PUV_21080Help
Entry
PUV_21080         CDS       T01552                                 

Gene name
maoA
Definition
flavin-containing monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:puv00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:puv00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:puv00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:puv00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:puv00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:puv00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2332650..2333975
Genome map
AA seq 441 aa AA seqDB search
MDVIVIGAGYAGLTCAYALAQKHWNVLLLEASHRPGGRALDYSLTDSHPVEMGGQYICKG
QKKIHALLNEFRIQTYETDNEGQHFLKNDRHNFLPLDSFHIPDEFNAALNLLEKMTRHVR
SSSAQHWNSITFQEWLNQSLQSPDAKQLFRFMINQGFSVEPEEVSLLQMLWLFKRNYGLP
TWTLGGAQASRIEGGSQALAHCLSESLGERIHYRQAVKTIIQNQEGVQVQTADQQFHAQA
VVVCIPPNRVKTLAFDPPLPPRYAQIFDAFQVVGQTLKIQAVYEKPFWRQQGWSGNGISL
TDIPMLTNDNSPLNSSLGVLSGMLTASAASKWMSKDQEERKNAVLQTWAHVFGKEALTPL
QYKEHDWTNDPFISCGQASYLSPNAPHEILEDSALPRVNRILWASSELAKDWSGCLEGAI
YAGEQAAQEIAMVLERSYASI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcatcgtcattggagccggttatgccggcttaacctgtgcttatgcactcgct
caaaaacattggaatgttcttttactagaagcatcacacagacccggtggacgtgcatta
gattatagcctaactgattcacatcctgtagaaatgggcggacaatacatttgtaagggg
caaaaaaaaattcatgctcttttaaatgaatttaggattcaaacgtacgagacagacaac
gaagggcaacattttttaaaaaatgatcgccacaattttttaccacttgattcctttcat
atccctgatgaatttaatgctgcattaaatctgcttgaaaaaatgacaagacatgtcagg
tcatcctctgctcaacattggaattcaattaccttccaagaatggctcaatcaaagcttg
caatctccagatgccaagcagttgtttcgtttcatgatcaaccaaggcttttcagtcgaa
cctgaagaggtgtcattacttcaaatgctttggttatttaaaagaaattatgggctacca
acatggacattgggaggcgctcaggccagtcgaatcgaaggaggatcacaagctcttgca
cattgtctttccgaatctctcggagagcgcattcattatcggcaagctgtcaaaacaatt
atacaaaatcaagaaggggtacaggtccaaacggctgatcagcaatttcatgctcaagca
gttgtggtttgcattccacctaatcgcgttaaaacacttgcgtttgatccgcctctccct
ccgcgatacgctcagatatttgatgcgtttcaagtagtgggacaaacgctgaaaatacaa
gctgtctatgaaaaaccattttggcgtcaacaaggttggtctggtaacggaatctcctta
actgatattccgatgttaacgaatgacaatagccctttaaactcttctttaggcgtttta
tcaggaatgctaaccgcttccgcagcatcaaaatggatgtccaaagatcaagaagaaaga
aaaaatgccgttttgcagacatgggctcatgtttttggaaaagaggctttaactcccctt
caatataaggaacatgattggacaaatgatccctttatctcctgtggacaagctagttac
ttatctccaaatgctcctcatgaaattttggaagattccgctttaccaagagtcaatcgc
attttatgggcttcttctgagctggcaaaagactggagtgggtgtttagaaggtgccatc
tatgccggggagcaagcggctcaagaaatagcaatggtcttggagagatcgtatgcctca
atatag

DBGET integrated database retrieval system