KEGG   Parachlamydia acanthamoebae: PUV_21080Help
Entry
PUV_21080         CDS       T01552                                 

Gene name
maoA
Definition
flavin-containing monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PUV_21080 (maoA)
   00330 Arginine and proline metabolism
    PUV_21080 (maoA)
   00340 Histidine metabolism
    PUV_21080 (maoA)
   00350 Tyrosine metabolism
    PUV_21080 (maoA)
   00360 Phenylalanine metabolism
    PUV_21080 (maoA)
   00380 Tryptophan metabolism
    PUV_21080 (maoA)
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     PUV_21080 (maoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2332650..2333975
Genome map
AA seq 441 aa AA seqDB search
MDVIVIGAGYAGLTCAYALAQKHWNVLLLEASHRPGGRALDYSLTDSHPVEMGGQYICKG
QKKIHALLNEFRIQTYETDNEGQHFLKNDRHNFLPLDSFHIPDEFNAALNLLEKMTRHVR
SSSAQHWNSITFQEWLNQSLQSPDAKQLFRFMINQGFSVEPEEVSLLQMLWLFKRNYGLP
TWTLGGAQASRIEGGSQALAHCLSESLGERIHYRQAVKTIIQNQEGVQVQTADQQFHAQA
VVVCIPPNRVKTLAFDPPLPPRYAQIFDAFQVVGQTLKIQAVYEKPFWRQQGWSGNGISL
TDIPMLTNDNSPLNSSLGVLSGMLTASAASKWMSKDQEERKNAVLQTWAHVFGKEALTPL
QYKEHDWTNDPFISCGQASYLSPNAPHEILEDSALPRVNRILWASSELAKDWSGCLEGAI
YAGEQAAQEIAMVLERSYASI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcatcgtcattggagccggttatgccggcttaacctgtgcttatgcactcgct
caaaaacattggaatgttcttttactagaagcatcacacagacccggtggacgtgcatta
gattatagcctaactgattcacatcctgtagaaatgggcggacaatacatttgtaagggg
caaaaaaaaattcatgctcttttaaatgaatttaggattcaaacgtacgagacagacaac
gaagggcaacattttttaaaaaatgatcgccacaattttttaccacttgattcctttcat
atccctgatgaatttaatgctgcattaaatctgcttgaaaaaatgacaagacatgtcagg
tcatcctctgctcaacattggaattcaattaccttccaagaatggctcaatcaaagcttg
caatctccagatgccaagcagttgtttcgtttcatgatcaaccaaggcttttcagtcgaa
cctgaagaggtgtcattacttcaaatgctttggttatttaaaagaaattatgggctacca
acatggacattgggaggcgctcaggccagtcgaatcgaaggaggatcacaagctcttgca
cattgtctttccgaatctctcggagagcgcattcattatcggcaagctgtcaaaacaatt
atacaaaatcaagaaggggtacaggtccaaacggctgatcagcaatttcatgctcaagca
gttgtggtttgcattccacctaatcgcgttaaaacacttgcgtttgatccgcctctccct
ccgcgatacgctcagatatttgatgcgtttcaagtagtgggacaaacgctgaaaatacaa
gctgtctatgaaaaaccattttggcgtcaacaaggttggtctggtaacggaatctcctta
actgatattccgatgttaacgaatgacaatagccctttaaactcttctttaggcgtttta
tcaggaatgctaaccgcttccgcagcatcaaaatggatgtccaaagatcaagaagaaaga
aaaaatgccgttttgcagacatgggctcatgtttttggaaaagaggctttaactcccctt
caatataaggaacatgattggacaaatgatccctttatctcctgtggacaagctagttac
ttatctccaaatgctcctcatgaaattttggaagattccgctttaccaagagtcaatcgc
attttatgggcttcttctgagctggcaaaagactggagtgggtgtttagaaggtgccatc
tatgccggggagcaagcggctcaagaaatagcaatggtcttggagagatcgtatgcctca
atatag

DBGET integrated database retrieval system