KEGG   Parachlamydia acanthamoebae: PUV_22030Help
Entry
PUV_22030         CDS       T01552                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PUV_22030
Enzymes [BR:puv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     PUV_22030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2417809..2420244)
Genome map
AA seq 811 aa AA seqDB search
MTEQSSEFSVETLQNGRPLNPLDPEEVRKIHAYWRAANYLSVGQIYLLDNPLLRRPLKAE
DVKPRLLGHWGTTPGLNFIYAHMNRVIKMYDLDVIYLAGPGHGGPGLVANVYLEGTYSEV
YPNVTQDEAGLKKLFKQFSFPGGIPSHVAPETPGSIHEGGELGYVMTHAFGAVFDNPDLI
ACCVIGDGEAETGPLAASWHSNKFLNPIHDGAVLPILHLNGYKIANPTILNRISREELQS
LLIGYGYKPYFVEGSEPEHMHQLMAATLELVIEEIKSIQQDARENGFKERPLWPMIVLAS
PKGWTGPKEIDGKKVEGYWRSHQVPFAEIAENPSHLLRLEEWLKSYKPEELFDEKGHFLA
EYAALAPKGKRRMGANPHANGGELLRDLRIPDFNDYALDIPAPGVVVAESARIMGNFLRD
VMKANLDQRNFRIMGPDETASNRWSALFEATNRMFTAEILSYDDHLSPDGRVMEVLSEHL
CQGWLEGYLLTGRHGFFSCYEAFIHVVDSMFNQHAKWLKTIRHIPWRRPIASLNYFLTSH
VWRQDHNGFSHQDPGFIDHVVNKKAEVIRVYLPPDANTLLSVTNHCLQSRNYVNVIIAGK
QPALHYLTMDEAIKHCSKGIGIWKWASNDYGEEPDVIMASCGDIPTLETLAAIDLLRKHI
PDIKIRMINVVDLMVLQPHTEHPHGLTDLEYDDLFTLDKPIVFAFHGYPWLIHRLTYRRA
SHENLHVRGYKEEGTTTTPFDMVVLNDLDRFHLMLDVVERIPRFSKMRAYIREFVEGKLI
DHTHYIRRVGDDMPEIRDWKWPYGYSSVVNK
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaatcttcagaattctctgtagagactcttcaaaatggacgacctcttaat
cctttagatcctgaagaggtaagaaaaattcatgcttattggagagctgcgaattatcta
tccgtcggacaaatttatcttctcgacaaccccttgctcaggcgaccgttaaaagctgaa
gacgtgaaaccgaggcttttaggtcactggggaaccaccccgggcttgaactttatttat
gcgcacatgaatagagtaatcaaaatgtatgatttggatgtcatttatttggccgggcct
ggtcacggagggccgggtttggttgcaaacgtttacttagaaggcacatatagtgaagtt
tatcccaatgtaacgcaagatgaagcaggcttaaaaaaattatttaagcaattttctttt
ccaggtggaattcctagccacgtcgcccccgaaactccagggtctattcatgagggtggg
gaattgggttatgtcatgacgcatgcctttggggcggtttttgataatcctgatttaatc
gcttgctgcgtcattggagatggagaagctgaaacaggacctctagctgctagttggcac
tccaataaatttctgaaccctatccatgatggggccgttttaccgattttacatttgaat
ggatacaagatcgctaatccaaccattctaaaccgaataagccgtgaagaactgcagagt
cttttaattggctacggatataagccttattttgtagaaggttcggagccggaacacatg
caccaattaatggctgcaacgcttgagctggtgattgaagaaattaaaagcattcagcaa
gatgcgcgagaaaatggatttaaagagcgccctctatggccaatgattgttttggcgtct
ccaaaaggttggacaggaccgaaagagattgatgggaaaaaagtagaggggtactggcgt
tcccaccaagttccttttgccgaaatagcagaaaatccgagtcatttgctgcggttggaa
gaatggttaaagagctataagccggaagagcttttcgatgaaaaggggcactttctcgca
gagtatgcagcacttgccccaaaaggaaagaggcgaatgggggcaaatccgcacgccaat
ggcggcgaattactaagggatcttcgcattccagattttaatgactatgcacttgatatt
cctgcaccaggagttgttgttgccgaatctgcccgaattatgggaaattttctccgcgac
gtgatgaaagccaatttagatcaaagaaattttcgcattatggggcctgatgaaacagct
tccaaccgctggagtgctctgtttgaagcgactaatcggatgtttacagcagagattctt
tcctacgatgatcatctttctccagatgggcgcgttatggaagtcctcagtgaacaccta
tgtcaaggatggcttgaggggtatttattgacgggaaggcatggatttttttcctgctat
gaagcatttatacatgtggtagattccatgttcaaccaacatgcaaaatggttaaaaaca
attcgtcatatcccttggagacgtccgattgcttcactaaattattttctgacttcgcac
gtttggcgacaggatcacaatgggttctcccaccaagatcccggttttatcgatcacgtg
gtcaacaaaaaagcggaagttatccgcgtttacttaccgcccgatgccaatacacttcta
tctgtcacaaatcattgtttacagagtcgtaattatgtcaatgtaatcatcgcaggaaag
caaccagcattgcattatttaacaatggatgaagcgattaagcattgttctaaaggaatt
ggaatttggaaatgggcgagtaacgactatggggaagagcctgatgtgatcatggcttct
tgtggagatattccgactctcgaaactttggctgcgatcgacttattgcgcaagcacatt
ccagatattaaaattagaatgatcaatgttgtggatttaatggttttacagccccataca
gagcacccacatggcttaactgatcttgagtatgacgatttgtttactctcgataaaccg
attgtgtttgcttttcatggctatccgtggttgattcaccgattgacctatcgtcgtgcg
agtcatgaaaatctacatgtgcggggctataaagaggaaggtactacgacgacacctttt
gatatggtggtattaaatgatcttgatcgctttcacctcatgttggatgttgtagagcgg
atccctcgcttcagcaaaatgcgcgcctatatcagagagtttgtcgaagggaagctgatt
gatcacacgcattacattcgacgtgtgggggatgacatgccagaaattcgagactggaaa
tggccttatggatactcatcagttgtaaataaatga

DBGET integrated database retrieval system