KEGG   Parachlamydia acanthamoebae: PUV_24590Help
Entry
PUV_24590         CDS       T01552                                 

Gene name
ybbD
Definition
lipoprotein ybbD
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
puv  Parachlamydia acanthamoebae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PUV_24590 (ybbD)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PUV_24590 (ybbD)
Enzymes [BR:puv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PUV_24590 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2687182..2688816)
Genome map
AA seq 544 aa AA seqDB search
MRKYIFWILLLFSYPPLHCQSNLPRLDELSIEEKVGQLLMVHFYGTEANGDAKKLIQDFH
IGGIIYYEWANGLADAQQVQILSRGLQSLAQERAHPIPLFLAIDQEGGVVNRLKNGFTQF
PGNYALGQIKKAGDAEACAYATGLELKSVGINVNLAPVVDVNCNEKNPIIGIRAFGSSPK
DVASLGKEMMEGFRKSSILSVLKHFPGHGDVEVDSHQALPCLNKTRGELDQVELYPFHQL
LPLSEAVMTSHLFVPALDAKTCITFSCDAVTQVLRKEMGFEGVILTDSLAMQGCLGQSQG
VVDAAIQSFKAGHDVLLLGGKQLLGEGGGFEITIDEIAKIHQTLVFLVQTGEISEQRLDA
SVRRILAAKKIYACQDLALSFDPSIHQQLAQKVADTATEVKYCQLQEKVSLKTQRILLVS
PSICQEAIEKSDLVHLAPLTTRYFYDSLSPEKEAFDAGVALAARSDLCVFCTYNAWRYPQ
QVTFVEALIKEGLPVIVVAGRDPWDQTLFSKASIVICTYSPVCCSFNSAAHLIRQEYQCA
TTNP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatatattttttggatacttttactatttagctatccaccccttcattgtcaa
agtaatctcccaagattagatgagctctccatagaggagaaagtcggccagcttttgatg
gtgcatttttacgggacagaggctaatggggatgcaaaaaaactcattcaggattttcat
attggaggaatcatttattatgagtgggctaatggattagcggatgcccagcaagtgcaa
attttaagccgagggctgcagtctttggcgcaggaacgggctcatccgattcctttattc
cttgcgattgatcaggaagggggcgtggttaatcgattgaaaaacggttttacgcaattc
ccaggaaattatgctttaggtcaaataaaaaaagcaggggatgccgaagcttgtgcttat
gccacaggattggaattaaagagtgtggggattaatgtaaatttggctcccgttgttgat
gtgaattgtaatgagaaaaatccgattataggtattcgggcttttggatcatcacccaaa
gatgtggcttctctcggaaaggaaatgatggaaggatttcgaaaatcctctattttgtcc
gtattaaaacattttcctggtcatggtgatgttgaagttgattcgcatcaagctttacct
tgcctgaacaaaacaagaggtgaattagatcaggtcgaactatatccttttcatcaactt
ctccctctttcggaggccgtgatgacatctcatttgtttgtgcccgcgcttgatgcaaaa
acatgtatcactttttcatgcgatgctgtgacgcaagtccttcgaaaagagatgggtttc
gaaggggtgattttgacagattctttggctatgcaaggatgtttagggcaatctcaaggt
gtcgtcgatgctgccattcaaagctttaaagcgggtcatgatgtgcttttattgggtgga
aagcagctgttgggagaaggagggggatttgaaatcacgatcgatgagattgcaaaaatc
catcagacccttgtgtttttagtccaaacgggagaaatttctgagcagagactcgacgca
tctgttcggagaattctagcagccaaaaaaatttatgcatgccaagatcttgctctatca
tttgatccatctattcatcaacaattggcacaaaaagtagcggatactgccacagaagtt
aagtattgtcagcttcaagaaaaagttagtttaaagactcagcgcatccttcttgtgtca
ccttctatttgtcaggaggcaatagaaaaaagtgacttagtgcacttagctcctttgaca
acccggtatttttatgattcattaagtcctgaaaaggaagcgtttgatgcgggggtagcc
ttagctgcgcggtccgacttatgcgtattctgtacttacaatgcatggcgatatccgcaa
caagtcacgtttgttgaggcattgataaaagaggggcttcctgttattgtggttgcaggg
cgagatccttgggatcaaactttattttcaaaagcatcgattgtcatttgcacttacagc
cctgtttgctgctcttttaattctgctgcacatttaattcgccaggagtatcaatgcgcg
actacaaacccttaa

DBGET integrated database retrieval system