KEGG   Parachlamydia acanthamoebae: PUV_24840Help
Entry
PUV_24840         CDS       T01552                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
puv  Parachlamydia acanthamoebae
Pathway
puv00020  Citrate cycle (TCA cycle)
puv00640  Propanoate metabolism
puv01100  Metabolic pathways
puv01110  Biosynthesis of secondary metabolites
puv01120  Microbial metabolism in diverse environments
puv01130  Biosynthesis of antibiotics
puv01200  Carbon metabolism
Module
puv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
puv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PUV_24840 (sucC)
   00640 Propanoate metabolism
    PUV_24840 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PUV_24840 (sucC)
Enzymes [BR:puv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PUV_24840 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CCB87434
UniProt: F8L2C1
Position
complement(2717406..2718569)
Genome map
AA seq 387 aa AA seqDB search
MNIHEFQAKNILKKYGVPISDYAVISKLEQLPHVLDQLKLDEAVLKIQVHAGGRGKAGGV
KIARSREEIRETAKTLLGMKLVNNQTGPEGVVAHQIIISPLVDVKKEYYLGAIIDRKKAQ
AVLIASPEGGMDIEEVAEKFPDKIMTVPISFNGDLKPFQQLKISQFMGWKGDIAKQGMRL
AKNIAKAFIETDASLLEINPLVLNAHDELIALDAKLSVDENALYRQPEIASYYDPSQIPA
NEAAAKEYDLAYVALDGEIGCMVNGAGLAMATMDIIHHYGGAPANFLDVGGGATQEKVAE
GFKIILADPKVKAILVNIFGGIMNCVTLAAGIISAAGELNVTVPLIIRMEGTNVEKGKKM
LQDSGVNIVIADSLAEAAEKVVAAVKK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatttcaagcgaaaaacattctaaaaaaatacggcgtgccgatttca
gactatgctgttatttctaaactagagcaacttcctcacgttttggatcagttaaaatta
gatgaagctgtcctaaaaatacaggttcatgcagggggaagaggcaaggcgggaggcgta
aaaattgccagaagtcgagaagagatcagagaaactgccaagactttgctggggatgaaa
cttgtaaataaccagacaggtcctgaaggtgttgttgcacatcaaattatcatttctcca
ttagttgatgtgaaaaaagaatattatttgggagctattattgaccgaaaaaaagcgcag
gcggttttaattgcttctcctgagggcggcatggacatcgaggaagtggccgagaaattt
cctgacaagataatgaccgtccccatcagttttaatggcgatttaaagccatttcagcaa
ttaaaaatctctcaatttatgggatggaagggggacattgccaagcaagggatgaggttg
gcaaaaaacatcgcgaaagcttttatcgaaacggacgcttccttactagaaattaatccc
ctcgtattgaatgcgcacgatgaactcattgccttagatgccaagctcagtgtcgatgaa
aatgcgctctatcgtcagccagaaatcgcttcttattatgatccctcacaaattcctgct
aatgaagcagcggcgaaagagtacgatcttgcctatgtggctctagacggagaaatcgga
tgcatggtcaatggagccggcttagctatggcaacgatggatattattcaccattatgga
ggcgcacctgctaattttctcgatgtaggaggaggggccacacaagaaaaagtggcggaa
ggatttaagattattttagccgatcccaaagtcaaggcgatcctagtcaatatctttggt
ggaattatgaattgtgtgaccctagctgcggggattatttcggctgctggagaactgaac
gtcaccgttcctctaatcattcgaatggaagggacgaatgttgaaaaaggcaaaaaaatg
ctccaagattcgggagtcaacattgtaattgcagatagtctggcagaagctgctgaaaaa
gttgttgcggctgtaaaaaagtaa

DBGET integrated database retrieval system