KEGG   Parachlamydia acanthamoebae: PUV_25460Help
Entry
PUV_25460         CDS       T01552                                 

Gene name
ruvA
Definition
hoLLiday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:puv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PUV_25460 (ruvA)
Enzymes [BR:puv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PUV_25460 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2790680..2791282
Genome map
AA seq 200 aa AA seqDB search
MYDYIKGMLISSSPTCAVIETSGIGYKIFIPTSTFGKLAQIGQNVQLYVSFVIREQSQTL
YGFFSAEERELFEILLAVSGIGPKTAIALIGHLPSTLLSAAIQGQDITTLSKVPGVGKKT
AERLIVELKDKLKIGVHPAAELVTATPFSEKSQTITDALNALTHLGYNQAIAKQAIQKTL
KEHSTDIDLATLITSTLKHI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatataaaagggatgctaatttcttcttcccccacctgtgcggttattgaa
actagtgggatcggatataagatatttatcccaacaagcacctttggaaagctggcgcaa
attggacaaaatgtgcagctgtatgtttcatttgtgattcgggagcaatcccaaactcta
tacggttttttttcagctgaagaaagagagctttttgaaattttgcttgcagtatccgga
atagggcccaagacggcaatcgccttgattggccatcttccatccacactattaagcgcc
gccattcaaggccaagatatcaccaccctttccaaggtgcctggcgtaggcaaaaaaaca
gccgagcgtttaattgtagaattgaaagataaattaaaaattggtgtacatccagccgcc
gaattagtgaccgcgactcctttctctgaaaagagtcaaaccattacagacgcgctgaat
gcactgacacatttaggttataatcaggccatagccaaacaagcgattcaaaaaacgtta
aaagaacactcaacagatattgatctagcaacgttgattacatccacacttaaacatatt
taa

DBGET integrated database retrieval system