KEGG   Parachlamydia acanthamoebae: PUV_26310Help
Entry
PUV_26310         CDS       T01552                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
puv  Parachlamydia acanthamoebae
Pathway
puv00521  Streptomycin biosynthesis
puv00523  Polyketide sugar unit biosynthesis
puv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PUV_26310
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PUV_26310
Enzymes [BR:puv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PUV_26310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA Cupin_1
Motif
Other DBs
NCBI-ProteinID: CCB87581
UniProt: F8KV59
Position
complement(2894822..2895379)
Genome map
AA seq 185 aa AA seqDB search
MEFISTPLKDAFLIDLNKLGDERGFFARLFCQKEFTQQGLEPAVVQVNNSYSVEKGTLRG
LHYQLPPFEETKLVRCIQGSLYDVIVDLRVDSPTFKKSFGAVLSAENRLMMYVPKGFAHG
FMTLQPNSEIMYFVSQFYSKECERGVRWDDPTFSIEWPAKPSLISERDKMHPNFDPSYHL
NLAAV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggaatttatatcgacacctctgaaagatgcttttctgattgatttaaacaagctgggt
gatgaacgcggattttttgcgcgtcttttctgccagaaagagtttactcaacaaggttta
gagcctgctgttgttcaagtgaataattcttatagtgttgaaaaaggaacattgcgtgga
ttgcattatcagcttcctccttttgaagaaaccaagctagtgcgatgcatacaaggctct
ttgtatgacgttattgtggacttacgtgtggattctcccacctttaaaaaatcttttggg
gccgtactttctgctgaaaatcgattgatgatgtatgtgccaaaaggatttgcacatggt
tttatgacgctgcagccgaattctgaaatcatgtacttcgtttcacaattttattctaaa
gaatgtgaaagaggggtgcgttgggatgacccaacctttagcattgagtggccagcaaag
ccaagcctgatttctgaaagggacaaaatgcatcctaattttgatcctagctatcattta
aacctggcggctgtataa

DBGET integrated database retrieval system