KEGG   Parachlamydia acanthamoebae: PUV_27270Help
Entry
PUV_27270         CDS       T01552                                 

Gene name
asnB
Definition
asparagine synthetase 1
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
puv  Parachlamydia acanthamoebae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PUV_27270 (asnB)
Enzymes [BR:puv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PUV_27270 (asnB)
Peptidases [BR:puv01002]
 Cysteine Peptidases
  Family C44
   PUV_27270 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2993405..2995348
Genome map
AA seq 647 aa AA seqDB search
MCGIAGIHQIKQNTYPHLHAHLDVMNRLQKHRGPDGEGIWKHPNRFIGFAHRRLNIIDIE
MGLQPMQDCYGNTICYNGEIYNYLELRAELKDYPFKTHSDTETILAAYQKWGKECVNHLR
GMFAFAIWDETNQRLFCARDRFGIKPFYFTEINHTLYFASEAKALLPFLPSIETNLEALQ
DYLVFQFSLGTKTLFKNIQELPPAYSLTVEKGKHVFSKYWEVYYDLDFDHTSRYFEEKLK
DLIEDSVKLHGRSDVPVGVYISGGIDSGIISAVTAQCSQNGLKGFNGKFDLGSEYDESEY
ARLLAKENNIELHEVNITSEDFLQTIHQIIYHLDYPIAGPGSFPQYHVAKLASQHCKVVL
GGQGGDEIFGGYARYLIAYFEQCIKAAINGTMDNGNFIVTYESIIPNLASLKNYKPLLQE
FWREGLFEDIDSRYFRLINRAPSLQDEIRWECFGPYSPFKEFQNVFHGKNVTKESYFDSM
THFDFKTLLRALLHVEDRMSMAHGIESRVPFLDHPLIEFAATMPSNIKFKDGTLKKVLIN
TMQHVLPQGILNRKDKMGFPVPLNHWLKNDLKDFAHDIFSSQSLQSRPYFNSTSILKNLG
SESKFGRKIWGLLSLELWHRLYHDRAPEFRKMVRDAEERIPFTTLSV
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgcaggaattcaccaaattaagcaaaacacctatcctcatcttcatgcc
catcttgatgtcatgaatcgcttgcaaaagcatcgaggacccgatggtgaaggcatttgg
aaacaccccaaccgttttattggatttgcgcatcgccggctcaacattatcgatattgaa
atgggcttgcagccgatgcaggattgttatggaaacacgatatgctataatggtgaaatc
tataattatcttgaacttagggcagagctgaaagattatccatttaaaactcattctgat
acagaaactattcttgctgcttatcaaaaatggggaaaagagtgtgtcaaccatttacgc
ggaatgtttgcctttgccatttgggatgagaccaatcaaagactattttgcgcacgcgac
cgctttggaataaaacccttctattttactgagataaatcacaccttatattttgcttcg
gaggcaaaagctctcctcccttttctcccttccattgagaccaatttagaagccttgcaa
gattatttggtttttcagttttctctagggactaaaacgctctttaagaatatccaagaa
cttcctcctgcttattctttgacggttgaaaagggaaaacatgtcttttcaaagtattgg
gaagtgtattacgatctagattttgatcacacatcccgatattttgaagaaaaattaaaa
gatttgatcgaagactctgtcaagcttcatggcagaagcgatgttccggttggggtatac
attagcggaggcatcgactcggggattatttcggcagtgaccgcacaatgctctcaaaat
ggtctgaaagggtttaatgggaaatttgatctgggatctgagtatgacgaaagcgaatac
gcccgtttactcgccaaagaaaacaacattgaactgcacgaagtcaatatcacgagtgaa
gactttttacagacgatccaccagattatttatcatctagattatcccattgctggaccg
ggttcttttcctcaataccatgtcgctaagttagcttctcaacattgtaaggtggtatta
ggggggcaaggaggcgatgaaatctttggtggttatgcccgttatctaattgcctatttt
gagcaatgtatcaaggccgcaattaacggaacgatggataatggaaattttatcgtcact
tatgaatcgattatccctaatctcgcttcgttgaaaaattataaacctctcctacaagaa
ttttggagagagggtctttttgaggatattgatagccgctattttagacttatcaaccga
gcaccttcattgcaagacgaaattcgatgggagtgttttggcccatattctccatttaaa
gaatttcaaaatgtttttcatggaaaaaatgtcacaaaagaatcttattttgattccatg
acgcattttgattttaaaacgcttctacgagctttgctccacgtggaagatcggatgagt
atggcacatggcattgagtcccgtgtcccttttcttgaccatcctttgattgaatttgct
gccacaatgccttcgaacatcaaatttaaagatggcacactgaagaaagtcttaattaat
acgatgcaacatgttcttcctcaaggaattcttaatcgcaaagataaaatgggcttccct
gttcctcttaatcattggttaaaaaatgatttaaaagattttgcacacgacattttctct
agccaatctttgcaaagtcgcccttattttaattccacaagtatcttaaaaaatctgggt
tccgaatctaaatttggaaggaaaatttggggattactttctctcgagctttggcatagg
ctttatcacgatagagcgcccgaatttagaaaaatggttcgagatgcggaagaaagaata
ccatttactacactgtcagtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system