KEGG   Pantoea vagans: Pvag_0032Help
Entry
Pvag_0032         CDS       T01326                                 

Gene name
holD
Definition
DNA polymerase III psi subunit (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pva  Pantoea vagans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pvag_0032 (holD)
   00240 Pyrimidine metabolism
    Pvag_0032 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pvag_0032 (holD)
   03430 Mismatch repair
    Pvag_0032 (holD)
   03440 Homologous recombination
    Pvag_0032 (holD)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pvag_0032 (holD)
DNA replication proteins [BR:pva03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pvag_0032 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28911..29321
Genome map
AA seq 136 aa AA seqDB search
MTSRRDWLLQQMGITQYQLRRPRVLQGEIAVTLAPDTQLIIVADAPPGLHEPLMRDVLHA
LNLQPDQVMTVTPDQLQMLPETLNCAGWLLGVESEQTFNGVALTSASFNELISSGVAKRA
LWQQMCNHDSHLFTHP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccaggcgcgactggcttttacagcaaatgggaattacacagtaccagctgcgc
cgcccgcgcgtgcttcagggcgaaattgccgtcacgctggcaccggacacgcagttaatt
attgtcgctgacgcaccacccggtctgcatgaaccgctgatgcgcgacgtgctgcatgct
cttaatctgcaacccgatcaggtgatgaccgtgacgccggatcagctgcaaatgctgccg
gagacgctgaactgcgcgggctggctgctcggcgtagagagtgaacagacttttaatggc
gtggctttaaccagcgcctctttcaatgaactgatcagtagcggcgtcgccaaacgcgcg
ctctggcaacagatgtgtaaccatgacagccatctctttactcacccctga

DBGET integrated database retrieval system