KEGG   Pantoea vagans: Pvag_0043Help
Entry
Pvag_0043         CDS       T01326                                 

Gene name
rbsk1
Definition
carbohydrate kinase (EC:2.7.1.-)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pva  Pantoea vagans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pvag_0043 (rbsk1)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pvag_0043 (rbsk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
40380..41297
Genome map
AA seq 305 aa AA seqDB search
MTIAVIGSNMVDLITYTNSLPKAGETLEAPDFAIGCGGKGANQAVAAAKMGGRVMMVSKV
GDDLFAPNTVANLQQQGVDTRFVTTAPGTSSGVAPIFVDDKSQNRILIIKGANQQLKPAD
IDDAAETLKACELIILQLEIPLETVYYAIDFARQHQIRVILNPAPAVATLDIHYACKCDF
FMPNETELEILTGLPVSTDEEVILAGQSLLKRGLKNLIITLGSRGSVWMSGDEVHRVAAT
PVQAVDTSGAGDAFIGCFAYLLVETGDVVTAMTQASAYAACSVTGRGTQCAYPDAEAFQR
FLNRN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgcggtcatcggctcaaacatggtcgatctgattacctacaccaacagcctg
ccgaaagcgggcgaaacccttgaagcgcccgactttgccattggctgcggcggtaaaggc
gctaaccaggcggtcgcggccgcgaaaatgggtggcagggtgatgatggtcagcaaggtc
ggcgacgacctctttgctcccaacaccgtagccaatttacagcagcagggcgtggacacg
cgttttgtcaccaccgcaccgggcacctccagcggcgtggcaccgatttttgtcgatgat
aagtcgcagaaccgcattctgattatcaaaggtgccaaccagcagcttaaaccagccgat
atcgacgacgcggctgagacactgaaagcctgtgagctgatcatcctgcagctggagatt
ccgctggagacggtctattacgccatcgattttgcccgccagcatcagatccgggtgatc
ctcaatccggcgccagccgtcgccacgctggatatccactacgcctgcaaatgcgacttc
ttcatgccgaacgaaaccgagctggagatcctcaccggcctgccggtcagcactgatgaa
gaggtgatcctcgccggtcagtcgctgctgaagcgcggccttaaaaatctgatcatcacg
ctggggagtcgcggttcggtctggatgagcggcgacgaggtgcatcgtgtggccgcaacg
ccggttcaggcggtcgataccagcggcgcgggcgatgcctttatcggctgctttgcgtat
ctgctggtggaaaccggcgatgtggtcaccgccatgactcaggcctcggcttatgccgcc
tgcagcgtcaccgggcgcggcacgcagtgtgcttatcccgacgccgaggctttccagcgt
tttctcaaccgtaactga

DBGET integrated database retrieval system