KEGG   Pantoea vagans: Pvag_0064Help
Entry
Pvag_0064         CDS       T01326                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pva  Pantoea vagans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pvag_0064 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pvag_0064 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pvag_0064 (thrC)
Enzymes [BR:pva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pvag_0064 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66658..67941
Genome map
AA seq 427 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGSQQGLFFPLELPEFELTDIDAMLEMDFVSRSSKILS
AFIGDEIPAHHLHERVKAAFAFPAPVKAVSEDIACLELFHGPTLAFKDFGGRFMAQMLSY
VSGSDEQITILTATSGDTGAAVAHAFYGMKNVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDACQSLVKQAFDDEELKKTIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLGNGEWQPNLTVSTLSN
AMDVSQPNNWPRVEELFRRKTWRLTDLACGAVSDETTRAAMRELAEIGYVSEPHAAIAWR
LLRDQLQEGEYGVFLGTAHPAKFRESVEAILEQTLTLPPELAERADLPLLSHEMKADFGS
LRAFLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatcttaaggatcacaacgagcaggtcagcttcgcccaggcggtgaaa
cagggtctgggatcgcagcagggtctgttctttccgctggaactgccagagtttgaactg
accgacatcgacgcgatgctggagatggattttgtcagccgcagcagcaaaattctctcg
gctttcattggcgacgagattccggcccatcatctgcatgagcgtgttaaagccgctttt
gcttttccggccccggtgaaagccgtcagcgaagatattgcctgtctggagctgttccac
gggccgacgctggcgtttaaagacttcggcggccgttttatggcgcagatgctgtcgtat
gtttcaggctcagatgagcagatcaccattctgaccgccacctccggtgataccggcgcg
gctgtggcgcacgcgttctacggcatgaagaacgtgcgcgtggtgatcctctatccgcag
ggcaaaatcagtccgctgcaggagaaactcttctgtacccttggcggcaacatcgaaacc
atcgctatcgacggcgattttgatgcctgtcagtcgcttgtgaaacaggcgtttgatgat
gaagagctgaaaaagacgattggtctgaactcggcgaactctatcaacatcagccgcctg
ctggcgcagatctgctactactttgaagcggtcgcgcagctgccgcaggaaaaacgtaat
cagctggtggtctccgtgccgagcggcaactttggtgatttgaccgccggtctgctggcg
aaatcgctgggcctgccgatcaagcgctttattgccgccaccaacgccaatgacacggtg
ccgcgcttccttggcaacggcgaatggcagcctaatctgacggtctctacgctgtcgaat
gcgatggacgtcagccagccaaacaactggccgcgtgtggaagagctgttccgccgtaaa
acctggcgcttaaccgatctcgcctgtggtgcggtctctgatgagaccacgcgcgccgca
atgcgtgaactggctgagattggctatgtttccgaaccacatgctgccatcgcctggcgt
ctgctgcgcgatcagctgcaggaaggggaatatggtgtgttcctgggtaccgcgcaccct
gcgaaattccgcgaaagcgtggaagcgatccttgaacagacactgacgctaccgccagag
ttagcggagcgtgccgatctgccgctgctgtcgcacgagatgaaggcggacttcggctca
ctgcgtgcgttcctgctgaagtag

DBGET integrated database retrieval system