KEGG   Pantoea vagans C9-1: Pvag_0064Help
Entry
Pvag_0064         CDS       T01326                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00260  Glycine, serine and threonine metabolism
pva00750  Vitamin B6 metabolism
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01120  Microbial metabolism in diverse environments
pva01230  Biosynthesis of amino acids
Module
pva_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pvag_0064 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pvag_0064 (thrC)
Enzymes [BR:pva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pvag_0064 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADO08284
UniProt: E1SCF8
Position
66658..67941
Genome map
AA seq 427 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGSQQGLFFPLELPEFELTDIDAMLEMDFVSRSSKILS
AFIGDEIPAHHLHERVKAAFAFPAPVKAVSEDIACLELFHGPTLAFKDFGGRFMAQMLSY
VSGSDEQITILTATSGDTGAAVAHAFYGMKNVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDACQSLVKQAFDDEELKKTIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLGNGEWQPNLTVSTLSN
AMDVSQPNNWPRVEELFRRKTWRLTDLACGAVSDETTRAAMRELAEIGYVSEPHAAIAWR
LLRDQLQEGEYGVFLGTAHPAKFRESVEAILEQTLTLPPELAERADLPLLSHEMKADFGS
LRAFLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatcttaaggatcacaacgagcaggtcagcttcgcccaggcggtgaaa
cagggtctgggatcgcagcagggtctgttctttccgctggaactgccagagtttgaactg
accgacatcgacgcgatgctggagatggattttgtcagccgcagcagcaaaattctctcg
gctttcattggcgacgagattccggcccatcatctgcatgagcgtgttaaagccgctttt
gcttttccggccccggtgaaagccgtcagcgaagatattgcctgtctggagctgttccac
gggccgacgctggcgtttaaagacttcggcggccgttttatggcgcagatgctgtcgtat
gtttcaggctcagatgagcagatcaccattctgaccgccacctccggtgataccggcgcg
gctgtggcgcacgcgttctacggcatgaagaacgtgcgcgtggtgatcctctatccgcag
ggcaaaatcagtccgctgcaggagaaactcttctgtacccttggcggcaacatcgaaacc
atcgctatcgacggcgattttgatgcctgtcagtcgcttgtgaaacaggcgtttgatgat
gaagagctgaaaaagacgattggtctgaactcggcgaactctatcaacatcagccgcctg
ctggcgcagatctgctactactttgaagcggtcgcgcagctgccgcaggaaaaacgtaat
cagctggtggtctccgtgccgagcggcaactttggtgatttgaccgccggtctgctggcg
aaatcgctgggcctgccgatcaagcgctttattgccgccaccaacgccaatgacacggtg
ccgcgcttccttggcaacggcgaatggcagcctaatctgacggtctctacgctgtcgaat
gcgatggacgtcagccagccaaacaactggccgcgtgtggaagagctgttccgccgtaaa
acctggcgcttaaccgatctcgcctgtggtgcggtctctgatgagaccacgcgcgccgca
atgcgtgaactggctgagattggctatgtttccgaaccacatgctgccatcgcctggcgt
ctgctgcgcgatcagctgcaggaaggggaatatggtgtgttcctgggtaccgcgcaccct
gcgaaattccgcgaaagcgtggaagcgatccttgaacagacactgacgctaccgccagag
ttagcggagcgtgccgatctgccgctgctgtcgcacgagatgaaggcggacttcggctca
ctgcgtgcgttcctgctgaagtag

DBGET integrated database retrieval system