KEGG   Pantoea vagans: Pvag_0116Help
Entry
Pvag_0116         CDS       T01326                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pva  Pantoea vagans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pva00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pva00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
129434..130921
Genome map
AA seq 495 aa AA seqDB search
MTDRNLRDLLGPWVPGAPARPLRDMTLDSRMAASGDLFVAVAGHQVDGRRFIPQAIAQGV
AAVVAEAEGEATDGEIREMHGVPVIYLAQLHQRLSALAGRFYQQPGEKQTLIGVTGTNGK
TTTTQLLAQWATLLGETSAVMGTVGNGLVGHLVAAENTTGSAVDVQHMLHELAEKGATLT
AMEVSSHGLVQHRVAALPFAAAVFTNLSRDHLDYHGDMPSYESAKWLLFSEHQVGQAILN
ADDEVGRRWLARLPDAVAVTMEDNLQSGCHGRWLKADAVEYHDNGAHIRFSSSWGNGEID
SPLMGAFNVSNLLLALATLLSLNYPLATLISVAPRLQPVNGRMEVFSAAGKPTVVVDYAH
TPDALEKALEAARLHCKGKLWCLFGCGGDRDKGKRPLMGAIAEQFADVVVITDDNPRSED
PQAIVKDILTGLLDPGRARVVSGRAQAVTNAIMQAQPDDIVLVAGKGHEDYQIIGNRRLD
YSDRATVAALLGGAA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgacagatcgtaacctgcgcgacttactcggcccctgggtgccaggcgcgccggcgcgc
ccattgcgcgacatgaccctggatagccgcatggcggcgtctggcgatctgtttgtcgct
gttgcaggccatcaggttgatggccgccgtttcattccgcaggcgattgcgcagggcgtc
gccgccgtggtggctgaagctgaaggtgaagcgactgacggcgaaatccgtgaaatgcac
ggcgtaccggtcatctatctggcacaactgcatcagcggctgtcggctttagcaggacgt
ttttatcagcagccgggcgagaagcagacgctgattggcgtcaccggcaccaacggtaaa
accacgactacccagctgctggcgcagtgggcaacgctgctgggtgagaccagcgcggtg
atgggcaccgtcggcaacgggctggtgggacacttagtcgcagcagaaaatactaccggt
tcagccgtggacgttcagcatatgctgcacgagctcgctgaaaaaggggcgaccctgacc
gcgatggaagtctcatcacatggtctggtgcagcatcgcgttgcggcgctgccgtttgct
gcggcggtcttcaccaacctcagtcgcgatcacctcgattaccacggtgacatgccgagc
tatgaatcggctaaatggctgctgttttctgaacatcaggtcggacaggcgattcttaac
gctgatgatgaagtcggccgtcgctggctggcgcgcttacctgatgcggttgccgtcacc
atggaagataaccttcaatcgggctgccatggccgctggctgaaagccgatgcggtggag
taccacgacaacggggctcatatccgtttcagctccagctggggcaacggtgaaatcgac
agcccgctgatgggcgcgttcaacgtcagcaatctgctgctggcgctggcgaccctgctg
tcactgaattatccgctggcgacgctgataagcgttgcaccacgattacagcccgttaac
gggcgtatggaagtgttcagcgctgcaggaaaaccgacggtcgtggtggattatgcccac
acgccggatgcgctggaaaaagcgctggaagcggcacgtctgcattgcaaaggaaaactc
tggtgcctgtttggctgcggcggcgaccgcgacaaaggcaagcgcccgttaatgggggcg
attgctgaacaatttgcggatgtggtggtgattaccgacgacaatccgcgcagcgaagat
ccgcaggcaatagtaaaagacattctgaccggtttgctggatccgggccgcgcccgcgtg
gtatcaggtcgtgcgcaagcggtcactaacgccattatgcaggcacaacctgacgatatc
gtgctggtggcgggcaaaggccatgaagattatcagatcatcggcaaccgtcgtctcgac
tactccgatcgtgccacggtagcggcactgctgggaggcgcagcatga

DBGET integrated database retrieval system