KEGG   Pantoea vagans: Pvag_0148Help
Entry
Pvag_0148         CDS       T01326                                 

Gene name
aceF
Definition
pyruvate dehydrogenase (dihydrolipoyltransacetylase component) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pva  Pantoea vagans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pva01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pva00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pva00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pva00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
164449..166353
Genome map
AA seq 634 aa AA seqDB search
MAIEIKVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIS
TGDKVETGSLIMVFDAEGAAEAAPAPAAEKKADAAPAPAAAAATASKEVAVPDIGGDEVE
VTEILVKVGDKVEAEQSLIVVEGDKASMEVPAPFAGVVKEITIATGDKVSTGSAIMVFEA
EGAAPASDAKPEVKEEAASAPAAAAGAKEVNVPDIGGDEVEVTEILVKVGDKVDAEQSLI
VVEGDKASMEVPAPFAGTVKELKVATGDKVSTGSLIMVFEVEGAAPAAPAAAKQEAAPAP
AAKSDAKPAAAAPAAKADSKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRIL
KEDVQTYVKDAVKRAEAAPAAVSGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANL
SRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPR
FNSSLSEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGITELSRELMAISKKARDG
KLTAGDMQGGCFTISSLGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFTPRLMMP
ISLSFDHRVIDGADGARFITIIGNMLSDIRRLVM
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaaggtaccggatatcgggtctgacgaagttgaagtcaccgagatt
ctggtgaaagttggcgacaaggtggaagccgagcagtcgctgatcaccgtggaaggcgac
aaagcctcaatggaagtgccgtcgccacaggctggcgtagtgaaagagattaagatctct
accggtgacaaagttgagaccggctcactgatcatggtgtttgatgctgaaggtgctgct
gaagcagcaccagcaccggccgcagagaaaaaagcggacgcggcgccagcgccagccgct
gctgcggccactgccagcaaagaagtggcggttccggatatcggcggtgacgaagtcgaa
gtcactgagattctggttaaggttggcgacaaagtcgaagccgagcagtcactgattgtg
gtggaaggtgataaagcctcaatggaagttccggctccgttcgcgggtgtggtcaaagag
atcaccattgcgaccggcgacaaagtcagcaccggatcagccatcatggtctttgaagca
gaaggcgcagcaccggcctctgatgcgaagccagaagtgaaagaagaagcagcatcggca
cccgctgctgctgcaggcgcaaaagaggtcaacgttccggatatcggcggtgatgaagtc
gaagtcaccgagatcctggtcaaagttggcgacaaagttgacgctgagcagtcactgatc
gtggttgaaggcgacaaagcctcaatggaagtccctgcgccgtttgcaggtacggtcaaa
gagctgaaagtcgcaacgggcgataaagtcagcaccggctcactgatcatggtgttcgaa
gtcgaaggtgcagctccggccgcccctgcggctgcgaaacaggaagctgctccggcgcct
gctgcgaaatctgatgctaagccagccgccgcggcgccagcagccaaagccgacagcaaa
ggtgagttcgcagagaacgacgcttacgttcacgcaactccggtgatccgtcgcctggcg
cgcgagttcggtgttaacctggcgaaagtcaaaggcaccggccgtaaaggtcgcattctg
aaagaagacgtgcagacttacgtgaaagacgccgtgaaacgcgctgaagcagcacctgct
gcggtaagcggcggtggtctgccgggcatgctgccatggccgaaagttgatttcagtaag
tttggcgaaatcgaagaagtcgaactgggtcgtatccagaaaatttctggcgcgaacctg
agccgtaattgggtgatgatcccgcacgttacgcatttcgacaaaaccgatatcaccgat
ctggaagcgttccgtaagcagcagaatgctgaagcagagaagcgtaagctggatgtgaag
tacacgcctgtcgtgttcatcatgaaagcggtcgcggcggcgcttgagcagatgccacgc
ttcaacagctcgctgtctgaagatgcgcagaaactgacgctgaagaaatatatcaacatc
ggtgtggcggttgatacgccaaatggcctggtcgttccggtcttcaaagacgtgaacaag
aagggcatcaccgagctgtcgcgtgaactgatggcgatttcgaagaaagcgcgtgacggt
aagctgacagcgggcgacatgcagggcggatgtttcaccatctccagcctgggcggcttg
ggcaccacacacttcgcgccgatcgttaacgcgccggaagtggctatcctgggtgtctct
aaatcggcgatggagccggtgtggaatggtaaagagtttacgccgcgtctgatgatgccg
atttctctctccttcgaccaccgcgtgatcgacggtgctgatggtgcgcgattcatcacc
attatcggcaatatgttgtctgacattcgtcgtttagttatgtaa

DBGET integrated database retrieval system