KEGG   Pantoea vagans C9-1: Pvag_0180Help
Entry
Pvag_0180         CDS       T01326                                 

Gene name
folK
Definition
(GenBank) 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00790  Folate biosynthesis
pva01100  Metabolic pathways
Module
pva_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pvag_0180 (folK)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Pvag_0180 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ADO08400
UniProt: E1SDV5
Position
complement(197452..197937)
Genome map
AA seq 161 aa AA seqDB search
MTRVYLALGSNLADPLHQVDAALTALDALPQTQRIATSPFYRTPPYGPPDQPDFLNAAVA
LETDLSAEALLDHTQQIERDHGRIRKEERWGPRTLDIDLMLFGDAVINTERLIVPHYDLL
NRAFMLVPLLAIAPDARLPDGRALSTVLATLGSSNIVLWHD
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacacgggtttacctcgcgttaggcagtaatctggccgatccgctgcatcaggttgat
gcagcgctgacagcactggatgcgttgccgcagacgcaacgcatcgcgacctcgccgttc
tatcgcacgccgccttatggcccgcccgatcagcccgattttctcaatgccgccgtggcg
ctggaaaccgatctcagcgctgaagccctgcttgaccatacccagcagattgagcgggat
catggccggatacgcaaggaagaacgctggggaccgcgcacgctggatatcgatctcatg
ctgtttggcgacgcagttattaacactgagcggctgattgtgccgcactacgacctgctg
aatcgcgcctttatgctggtgcccctgctggcgattgcgcccgatgcccgcctgcccgat
ggccgcgcactcagcaccgttctggccaccctcggcagcagcaacatcgtgctgtggcac
gactga

DBGET integrated database retrieval system