KEGG   Pantoea vagans C9-1: Pvag_0266Help
Entry
Pvag_0266         CDS       T01326                                 

Definition
(GenBank) acireductone dioxygenase, ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00270  Cysteine and methionine metabolism
pva01100  Metabolic pathways
Module
pva_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pvag_0266
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Pvag_0266
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Pvag_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ADO08480
UniProt: E1SEI9
Position
290001..290543
Genome map
AA seq 180 aa AA seqDB search
MSALTIFTDREASQPVWYSTDAEAIRDRLNAKGVRFERWEADRDLGENPDAETVINAYQH
AIDRLVAEKGYQSWDVISMRADNPQKTVLREKFLNEHTHGEDEVRFFVEGAGLFCLHLDG
EILQILCEKNDLISVPAGTPHWFDMGSSPHFTAIRIFDNQEGWVANFTGDKIADAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcactgactatttttaccgaccgcgaagccagccagccggtgtggtacagcacc
gacgcagaagcgattcgtgaccgtctgaatgctaaaggcgtccgttttgaacgctgggaa
gccgatcgcgatttgggtgaaaacccggatgccgaaacggtgatcaacgcctatcagcat
gcgatcgatcggctggtggcggagaagggctatcagagctgggacgtgatcagcatgcgt
gccgacaatccgcagaaaaccgtgctgcgcgagaagtttctcaatgagcatacgcacggc
gaagatgaggtgcgtttctttgtcgagggggccgggctgttctgcctgcatctggatggc
gagatcctgcagatcctgtgcgagaaaaatgatctgatctcggtgcccgcgggcaccccg
cactggttcgatatgggatcgtcaccgcacttcacggcgattcggattttcgataatcag
gaaggctgggtagcgaactttaccggcgacaagatcgcggatgcctatccgcgtctggcg
taa

DBGET integrated database retrieval system