KEGG   Pantoea vagans C9-1: Pvag_0282Help
Entry
Pvag_0282         CDS       T01326                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00330  Arginine and proline metabolism
pva00332  Carbapenem biosynthesis
pva01100  Metabolic pathways
pva01130  Biosynthesis of antibiotics
pva01230  Biosynthesis of amino acids
Module
pva_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pvag_0282 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Pvag_0282 (proB)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Pvag_0282 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADO08496
UniProt: E1SEK5
Position
309072..310175
Genome map
AA seq 367 aa AA seqDB search
MSGSQTLVVKLGTSVLTGGSRRLNRAHMVELVRQCAQQHAAGHRIVIVTSGAMAAGREHL
GYPELPPTIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDT
LRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAMLGGADKLLLLTDQQGLFTADPR
NNPDAELISDVHVIDDALRALAGDSVSGLGTGGMSTKLQAADVACRAGIDVIIASGSRSG
VISDVIDGKPVGTRFHAQQSPLENRKRWIFGAPPAGELTVDDGALAAIIERGSSLLPKGI
RAIQGNFSRGEVIRIRSLQGRDIAHGVSRYNSDAMRMIAGHHSQQISEILGYEYGPVAVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcagtcagaccttagtggtcaagttgggtaccagcgttcttaccggtggctct
cgccggttaaatcgggcgcacatggtggaactggttcgtcagtgcgcgcagcagcatgcc
gcaggccaccgcattgtgatcgtcacttctggcgcgatggccgccggacgcgaacatctg
ggctaccccgaactgccacccaccatcgcctcaaagcagctgctggctgcggtggggcag
agccgtctgattcagctgtgggaacagttattctccatctatggcatccatattggtcag
atgctgctgacccgtgccgacatggaagatcgcgaacgtttcctgaatgcccgcgatacg
ctgcgcgcgttgctggataaccacattgtgccggtgatcaacgagaacgatgcggttgct
accgctgaaatcaaagtgggcgacaacgacaatctttcggcgctggcggcgatgctcggc
ggtgccgacaagctgctgctgctgaccgatcagcagggtctgtttaccgccgatccgcgc
aacaatcctgacgctgagctgatcagcgacgtccacgtgatcgatgatgcgttacgcgcg
ctcgcgggtgacagcgtatccggtctcggcaccggcggtatgtcgaccaagcttcaggcg
gcggatgttgcctgccgcgccggaatagacgtgattatcgcctcgggcagtcgcagcggt
gtgatcagcgatgtgattgacggtaagccggttggtacgcgattccatgcacagcaatcg
ccgctggagaaccgtaaacgctggattttcggtgcgccaccggcgggcgaactcaccgtc
gatgacggggcactggcggccatcattgaacgcggcagttcgctgctgcccaagggcatt
cgcgcaatccaggggaatttctcacgcggtgaagtgatccgcatccgcagcctgcagggc
cgggatattgctcacggtgtttctcgctacaacagtgacgcgatgcgcatgattgccggc
catcacagccagcagatcagcgaaattctgggatatgaatatggcccggtggccgttcac
cgcgacgacatgatcgtcagttaa

DBGET integrated database retrieval system