KEGG   Pantoea vagans: Pvag_0413Help
Entry
Pvag_0413         CDS       T01326                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
pva  Pantoea vagans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pva00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pvag_0413 (recR)
DNA repair and recombination proteins [BR:pva03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pvag_0413 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
444159..444764
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMESLRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCSDC
RTFTEQEICTICANPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPLDGIGP
ADIGLDRLEQRLESETLQEVILATNPTVEGEATANYIAELCGQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRQKFKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccactgcttgaatcattgatggagtcgctgcgctgtctgcccggcgtt
gggccgaagtcggcacagcgcatggcttttcagctgctgcagcgcgatcgcagcggtggc
atgcggctggcacaggcgctgacccgggcgatgtcggagatcggacactgttctgactgc
cggacattcaccgagcaggaaatttgcaccatctgtgccaatccacggcgtcagcagaat
ggtcaaatctgcgtggtagaaagcccggcagatatccacgccattgagcaaaccggtcag
tttggcggtcgctactttgtgctgatggggcatctctcgccgctcgacggcatcggtccg
gcggacatcggtctggatcgtctggagcagcggctggagagtgaaacgctgcaggaagtg
atcctcgccaccaacccgacggtagaaggcgaggcaaccgcaaactacatcgcggagctc
tgtggccagtatggcgttgacgccagccgtatcgcgcacggtgtaccggtaggcggagag
cttgagatggtggatggcaccacgctgtcccactcgctggcaggtcgccagaagtttaaa
ttttaa

DBGET integrated database retrieval system