KEGG   Pantoea vagans: Pvag_0549Help
Entry
Pvag_0549         CDS       T01326                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase (dihydrolipoyltranssuccinase E2 component) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pva  Pantoea vagans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pvag_0549 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pvag_0549 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Pvag_0549 (sucB)
Enzymes [BR:pva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pvag_0549 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
574741..575964
Genome map
AA seq 407 aa AA seqDB search
MSSVDILVPDLPESVADASVATWHKKPGDAVTRDEVLVEIETDKVVLEVPASADGILEAV
LEEEGATVTSRQILGRLKEGNSAGKETSAKSESKESTPAQRQTASLEEESNDALSPAIRR
LIAEHNLDASQIKGSGVGGRLTREDVEKHLANKPQTGKAAAPAAETAAVQQPVANRSEKR
VPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGEAFEKRHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDALSMADIEKK
IKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
NGQVVVLPMMYLALSYDHRLIDGRESVGYLVAVKEMLEDPARLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctcgttcccgacctgcctgaatcggttgccgatgcctccgtg
gcaacctggcacaaaaaaccaggcgatgcagtgactcgcgatgaagtgctggtcgaaatc
gaaaccgacaaagtggtgctggaagtgccagcctctgctgacggtattctggaagcggtt
ctggaagaagagggcgccaccgtcacttcacgccagattctgggtcgtctgaaagagggc
aacagcgccggtaaagagaccagcgcgaagtctgaaagcaaagagtctaccccggctcag
cgtcagactgcgtcactggaagaagagagcaacgatgcgctcagcccggccatccgccgt
ctgattgccgagcacaaccttgatgcttcgcagatcaaaggcagcggtgtgggcggacgt
ctgacccgtgaagatgttgaaaaacatctggccaacaaaccgcagaccggcaaagccgcc
gcacctgcggcagaaactgcagccgtgcagcagcctgtggcgaatcgcagcgaaaaacgc
gtgccgatgacccgtctgcgtaagcgtgttgccgagcgtctgctggaagcgaaaaacagc
actgcgatgctgaccaccttcaacgaaatcaacatgaagcccatcatggatctgcgcaag
cagtatggtgaggccttcgagaagcgtcacggtgtacgtctgggctttatgtccttctac
atcaaagcggttgttgaagcactgaaacgttacccggaagtgaatgcctccatcgatggc
gaagatgtggtttaccacaactacttcgacgtcagcatcgcggtctctacgccacgcggt
ctggtgacaccggttctgcgtgacgttgatgcgctgagcatggcggacattgagaagaaa
atcaaagagctggcagtgaaaggccgtgacggcaagctgacagtagacgatctgaccggc
ggtaacttcaccattaccaatggcggcgtctttggttccctgatgtccaccccgatcatc
aacccaccgcagagcgccatcctgggcatgcacgctatcaaagatcgcccgatggcggtc
aatggtcaggttgtggtgctgccaatgatgtacctggcgctctcctacgaccaccgtctg
atcgatggccgtgaatcagtgggttatctggttgcagtgaaagagatgctggaagatccg
gcgcgtctgctgctggatgtctga

DBGET integrated database retrieval system