KEGG   Pantoea vagans: Pvag_0621Help
Entry
Pvag_0621         CDS       T01326                                 

Gene name
dld
Definition
(GenBank) D-lactate dehydrogenase
  KO
K03777  
D-lactate dehydrogenase (quinone) [EC:1.1.5.12]
Organism
pva  Pantoea vagans
Pathway
Pyruvate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pvag_0621 (dld)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.12  D-lactate dehydrogenase (quinone)
     Pvag_0621 (dld)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(650199..651902)
Genome map
AA seq 567 aa AA seqDB search
MIQTSALLSDLRRLVGPAHLLTEPEQTARYRKGFRSGEGEALAVAFPGTLLELWRVLQTL
VKADVIILMQAANTGLTEGSTPHGNDYDRPLVIVSTLRLDKLQLIDEGQQVLAFPGSTLY
QLEKALKPLGREPHSVIGSSCIGASVLGGICNNSGGSLIKRGPAYSEMALYAQIDAQGRL
KLVNHLGIDLGTSPEEILGRLDDDRWQPGDVQHDGRHASDHEYADRVREVDADTPARYNA
DARRLFEASGCAGKLAVFAVRLDTFPSEPQQQVFYIGTNEPGVLNDIRRHILAHFTHLPV
AGEYMHRDIYDIAEVYGKDTFLMIDKLGTDKMPLFFTLKGRVDAWLSKLSFVKPHFSDRL
LQRLSKLFPAHLPKRMKQYRDKYEHHLMLKMSGDGVAEARNYLRDYFREGGGEFFECEGK
EGAHAFLHRFAAAGAAVRYHAVHADEVEDILALDIALRRNDADWFETLPDAIRASLSHRL
YYGHFFCHVFHQDYIVRKGVDVHALKAQMLEILQARGAEYPAEHNVGHLYQAKPQLAAFY
RQLDPTNSFNPGIGKTSKQKSWAVKQV
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaacctctgccctgctttctgaccttcgccgcctggtcggccctgcccatctg
ctgacagaacctgaacagactgcccgctatcgcaaaggctttcgctccggcgaaggtgag
gcgctggccgtggcgtttcccggtacgctgctggagctctggcgggtattgcagacgctg
gtgaaagcggatgtcatcatcctgatgcaggcggcgaataccggcctgaccgaaggttca
acaccacatggcaatgattacgaccgtccgctggtgattgtcagtaccctgcgactggat
aagcttcagctgatcgacgaaggccagcaggtgctggcgttccccggcagcacactctat
cagctggaaaaagcgctgaagccgctgggacgtgaaccccactcggtgattggctcctca
tgcattggggcctcggtgctgggtggcatctgtaataactccggcggatcgctgattaag
cgcggcccggcctacagtgagatggccctgtatgcgcagattgatgcacagggaagactg
aagctggtgaaccatctgggtatcgatctggggacctcgccggaagagattctgggacgg
ctggatgacgaccgctggcagcccggcgacgtgcagcacgatggccgtcacgcctccgat
catgaatatgccgaccgggtccgtgaagtcgatgcggatacgcccgcccgttacaacgcc
gatgcgcgtcgcctgtttgaagcgtccggctgtgccggaaaactggcggtctttgcggtg
cgactcgatactttccccagcgaaccgcagcagcaggtgttttacatcggcaccaacgaa
cccggtgtgcttaacgatatccgccgtcacatcctggcgcatttcacccatctgccggtg
gcgggcgaatatatgcaccgcgacatttatgacattgcggaagtctacggcaaagacacc
ttcctgatgatcgacaagctgggcaccgacaagatgccgctgtttttcacgctgaaagga
cgggttgacgcctggctgagcaagctctccttcgttaaaccgcacttcagcgaccggctg
ttgcagcgcctgagcaaactgttcccggcgcatctgcccaaacgcatgaagcagtatcgc
gacaaatatgaacatcatctgatgctgaagatgtcgggcgacggcgtggcagaagcgcgt
aactatctgcgcgactacttccgtgaaggcggtggcgagttcttcgagtgtgaaggcaaa
gaaggtgcgcacgcgtttctgcatcgctttgcggcagcgggcgcggcggtgcgctaccac
gcagtccatgcagatgaggtcgaagatattctggcgctggacattgccctgcgtcgcaac
gatgcggactggttcgaaaccctgcccgatgcgatccgtgcatccttaagccatcgcctc
tactatggtcacttcttctgtcatgttttccatcaggattacatcgtcagaaaaggggtg
gatgtgcatgcactgaaagcgcagatgctggagatcctgcaggcgcgcggggcggaatat
cccgctgagcataatgtcggccatctctatcaggcaaaaccgcagctggcggcgttctat
cgccagctcgatccgaccaatagcttcaatcctggcattggcaaaaccagcaagcaaaaa
agctgggcggtgaagcaggtttaa

DBGET integrated database retrieval system