KEGG   Pantoea vagans: Pvag_0655Help
Entry
Pvag_0655         CDS       T01326                                 

Gene name
huth3
Definition
histidine ammonia-lyase (EC:4.3.1.3)
Orthology
K01745  
histidine ammonia-lyase [EC:4.3.1.3]
Organism
pva  Pantoea vagans
Pathway
Histidine metabolism
Metabolic pathways
Module
Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Pvag_0655 (huth3)
Enzymes [BR:pva01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     Pvag_0655 (huth3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
688645..690162
Genome map
AA seq 505 aa AA seqDB search
MSGVTKQRRVWGDGPLKWQELVQVARHGATLTLSDSAWQRIAQSREIVGNIVAAGQVAYG
INTGLGALCNITLSEDELGQLSRNTLMSHACGVGPVLKKAEVRAILCAAIANYSHGKSGV
SVALVQQLLALLNLQITPQVPSQGSVGYLTHMAHIGLALIGIGEVEWRGEIIPAQQALEQ
AGLAPYRPGAKEGLSLVNGTPCMTGLACLALDDAERLLDWADVTGAMSFEALRGQLVAFD
PEVLALKASPGIQRSGERLRQLLRDSPLLNASVGIRTQDALSLRSMPQVHGACRDQFDHA
ARQVETELNACTDNPLILGTPQAWRVVSQSHPHGESVAMACDLLAIALAELGSIAERRLD
RLVNPLVSGLPPFLVAEPGVNSGMMIAQYVAASLCAENRQLAQPAVLDNYVTSGLQEDHL
SLGTGSALKLLKLVSNVDHIIAIEYLLAAQALEFHGESELAAGTRRAWQLLRQVVDRWQQ
DRWLAPDIARAVAQIKAHRADALME
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgtgacgaagcagaggcgggtctggggcgatggtccgctcaaatggcaggaa
ctggtgcaggttgcccggcacggtgccaccctgacgctgagcgacagtgcctggcagcgc
atcgcgcagagtcgtgaaatcgtcggcaacatcgtggcggcggggcaggtggcgtacggt
atcaataccgggctgggagcgctctgtaacatcacgctgtctgaagatgagctgggccag
ctgtcgcgcaatacgctgatgagccatgcctgcggcgtcggaccggtgctgaaaaaagcg
gaggtgcgcgccattctgtgcgccgcgattgctaactacagccacggcaaatcgggtgtc
tcagtggcgctggtgcagcagctgctggcgctgctgaatctgcagattacgccacaggtg
ccgtcgcagggatcggtgggctatctgacccacatggcgcatatcggcctggcgctgatt
ggtattggcgaggtggagtggcgtggcgaaatcatccccgcgcagcaggcgctggaacag
gcggggttagccccttaccggcctggcgcaaaagaggggctgagcctggttaacggcacg
ccctgcatgaccggcttagcctgtctggcactggacgatgctgaacgtctgctggactgg
gcggatgttaccggcgcaatgagctttgaggcgctgcgcggacagctggtggcctttgac
cctgaggtgctggcgctcaaggccagtccggggattcagcgcagcggcgaacgtctgcgc
cagttgttacgtgacagcccgctgctgaacgcgagcgtcggcatccggactcaggatgcg
ctgagcctgcggtcgatgccgcaggtgcacggtgcctgccgcgatcagttcgaccatgcc
gcccgtcaggtggagaccgaactcaacgcctgtaccgacaacccactgattctgggcacg
ccacaggcctggcgcgtggtgtcgcagtcacatccgcacggtgagtcggtggcgatggcc
tgcgacctgctggcgattgcgctggcggagctgggcagtattgctgagcgacggctggat
cggctggtcaatccgcttgtcagcggcctgccgccatttctggttgcggagcctggcgtc
aattccggcatgatgattgcgcaatatgtggcggcctcgctttgcgcggaaaaccgtcag
ctggcgcagcctgcggtgctcgacaactatgtgacgtcgggattacaggaggatcatctg
agtctcggcaccgggtcggcgctgaaactgctgaagctggtcagcaatgtcgatcacatt
atcgcgattgagtatctgctggcggcgcaggcgctggagtttcatggtgaatcagagctg
gcagcgggcacgcggcgcgcctggcagctgttgcggcaggtggttgatcgctggcagcag
gatcgctggctggcccccgatatcgcccgcgcggtggcgcagataaaagcgcaccgggcc
gatgcgcttatggagtga

DBGET integrated database retrieval system