KEGG   Pantoea vagans: Pvag_0972Help
Entry
Pvag_0972         CDS       T01326                                 

Gene name
gpma3
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pva  Pantoea vagans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pvag_0972 (gpma3)
   01230 Biosynthesis of amino acids
    Pvag_0972 (gpma3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_0972 (gpma3)
  Energy metabolism
   00680 Methane metabolism
    Pvag_0972 (gpma3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pvag_0972 (gpma3)
Enzymes [BR:pva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Pvag_0972 (gpma3)
Exosome [BR:pva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Pvag_0972 (gpma3)
  Exosomal proteins of melanoma cells
   Pvag_0972 (gpma3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1026932..1027462)
Genome map
AA seq 176 aa AA seqDB search
MRLCAARNRSTGRPAAGTGAQSLAPSTLILLRHGESQWNRENRFTGWTDVPLTDRGRQEA
DRAGDVLRDAGLLPDRVFTSVMTRCVHTVWRVLDRLGRSWTPVDKHWRLNERHYGALQGL
NKEAAARMMGAETVRLWRKSFSGIPPRTQGLRRSCVGTRATAALRWPTCLRRKAWK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgtgcgccgcacgtaacagatccaccggacggccagcggccggcacaggagca
cagtctttggcaccttcaacgctgattctcctgcgccatggcgaaagccagtggaaccgg
gaaaaccgttttaccggatggacagacgtgccgctgacggaccgggggcggcaggaggct
gaccgggccggtgacgtgctgcgggacgcgggcctgctgcccgatcgggtcttcacctcg
gtgatgacgcgctgtgttcacacggtctggcgggtgctggaccgtcttggccgcagctgg
acgcccgtggacaaacactggcggctgaacgagcggcactacggtgcgctgcaggggctg
aacaaggaagcggctgcccggatgatgggtgcagagaccgtccggctctggcgcaaaagc
ttcagcggcattcccccgcggacgcaggggctccggcgcagctgcgtcgggacccgcgct
acagccgcgttgcgctggccgacctgcctgcgacggaaagcctggaaatga

DBGET integrated database retrieval system