KEGG   Pantoea vagans: Pvag_1006Help
Entry
Pvag_1006         CDS       T01326                                 

Gene name
glpk1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pva  Pantoea vagans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pvag_1006 (glpk1)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pvag_1006 (glpk1)
Exosome [BR:pva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pvag_1006 (glpk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052827..1054314
Genome map
AA seq 495 aa AA seqDB search
MVGPLILAIDEGTTNAKAIAVDRSGRVVARGSQSLTLQHPQPGLAEQDPMAIWQAVKQAI
IQCLSACDGAPVAAVAISNQRESVLIWQRRDGQPLTPLVSWQDRRSEAFCRDLHQAGKAP
RITGLTGLAVDPMFPAAKLTGMLAAIPDGAARAAAGELCIGTVDSWLSWQLSAGEVFVTD
HANAARTQLYSLHLNDWDDELLTLFQLPRAALPRITSSASEQGVVAVRDIPGLAPGTPIL
ARIGDSHAALQAQRRGESEVVKATYGTGSSLMMSMATPLLTENGLSTTVAWHDGTLRYAF
EGNITHTGSGAAWLGKLLGVQDPRALTAMAQRCDDNQGIYFVPALSGLGAPWWDLQARGM
VCGLTDAATPDVLARVALESIVWQIADVFFAMEQASGQQLPALCVDGSATENSWLMQLQA
DVLQRPLQRVPTAEVSALGAALLAGKVLGWWQQGSDMQALQGGSVIMPREEHAQRMQENY
KGWIDAVARCRYQPH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtgggacccctgattctggcgatcgacgaaggcaccaccaacgccaaggcgattgcg
gttgatcgcagtggccgcgtcgtggcgcgcggcagccagagtttaaccctgcaacatccg
cagcccggactggcggagcaggaccctatggcaatctggcaggcggtaaagcaggcaatc
atccagtgtctgtcagcctgtgatggcgcgcctgtcgcggccgtggcgatcagcaatcag
cgcgagtcggtgctgatctggcagcggcgtgatggtcagccgctgacgccactggtgagc
tggcaggatcgacgctcagaggcattctgtcgcgatctgcaccaggcgggcaaagcgcca
cgtattaccggtctgaccgggctggccgttgatccgatgtttccggccgccaagctgacc
gggatgctggccgccattcccgacggtgcggcgcgggccgcagccggtgagctttgcatc
ggcaccgtcgacagctggctcagctggcagctcagcgcaggtgaggtattcgttaccgat
cacgccaacgccgcccgcactcaactttatagtctgcatcttaatgactgggacgatgag
ctgctgacgctgtttcagctaccgcgcgccgcgctgccacgtattacctcctccgccagc
gaacagggtgtggtcgcggtgcgtgacattcccggcttagcgcccggcacgcccattctg
gcgcgcatcggtgactcccatgctgcgctgcaggcgcagcggcgcggcgagtcggaagtg
gtgaaagccacttacggcaccggctcctcactgatgatgtcgatggcgacgccgctgctg
acggaaaatggcctcagcaccaccgtggcctggcacgacggcacgctgcgttatgcgttt
gaaggcaatatcacccacaccggttccggtgccgcctggctgggcaaactgctcggcgtg
caggatccgcgtgcgctgaccgccatggcgcagcgctgtgacgacaatcagggcatctat
tttgtcccggcgctctccggcctgggcgcgccctggtgggatctgcaggcgcgcggcatg
gtatgcggactgacggacgccgccacgcccgacgtactggcgcgtgtcgcgctggagtcg
atcgtctggcaaatcgccgacgtcttttttgcgatggagcaggccagcggccagcagctc
ccggccctctgtgtggatggcagcgccaccgaaaacagctggctgatgcagttacaggcg
gatgtgttacagcggccgctgcagcgggtgccgaccgccgaagtatccgcgctgggcgcg
gcgctgctggcgggcaaagtactgggatggtggcagcagggcagtgatatgcaggcgctg
cagggcggcagtgtcatcatgccgcgtgaagagcacgcgcagcgtatgcaggaaaactat
aaaggctggatcgacgccgttgcacgctgtcgttatcagccacattaa

DBGET integrated database retrieval system