KEGG   Pantoea vagans: Pvag_1143Help
Entry
Pvag_1143         CDS       T01326                                 

Gene name
btuE
Definition
vitamin B12 ABC transporter
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pva  Pantoea vagans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pvag_1143 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pvag_1143 (btuE)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pvag_1143 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211033..1211578
Genome map
AA seq 181 aa AA seqDB search
MNIYETELVTLDGEKTTLSQWQGKVLLVVNVASKCGLTPQYEELENLQKAWQDQGFSVLG
FPCNQFLEQEPGSSEEIKTFCSTTYGVTFPLFAKTEVNGPARHPLYAQLIAARPDAVRPE
GSGFYERMESKGRAPKEQGDILWNFEKFLIGRDGSVIQRFAPDMTPEDPIILETIKQALA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttatgagactgaactggttacgctcgacggggaaaaaaccacgctgtcacag
tggcagggcaaagttctgctggtcgtcaacgttgcctcgaaatgtggtctgacgccgcaa
tacgaagagctggagaatctgcagaaagcctggcaggatcagggcttcagcgtcctcggt
ttcccctgcaatcagtttctggaacaggaaccgggcagcagtgaggagatcaaaactttc
tgcagtaccacctatggcgtaacgttcccgctgtttgccaaaaccgaggttaatggcccg
gcgcgtcatccgctctatgcgcagctgatcgcggcccggcctgacgcggtgcgtccggaa
ggcagcggtttttacgaacgtatggagagtaaagggcgcgcgccgaaagagcagggcgac
atcctgtggaactttgaaaagttcctgattggccgtgacggcagtgtgatccagcgtttt
gcacctgacatgacgccggaagatcccatcattctggaaacgattaaacaggcgctggca
aaatag

DBGET integrated database retrieval system