KEGG   Pantoea vagans: Pvag_1508Help
Entry
Pvag_1508         CDS       T01326                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pva  Pantoea vagans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pvag_1508 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pvag_1508 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pvag_1508 (trpB)
Enzymes [BR:pva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pvag_1508 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1592664..1593854
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGMYVPQILMPALRQLEQAFVDAQKDPEFQAEFTDLLKNYAGRPTALTL
CKNLTKGTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGMKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSY
ETSHYMLGTAAGPHPFPTIVREFQRMIGEETKKQILEREGRLPDAILACVGGGSNAIGMF
ADFIDETSVKLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKSPMMQTHDGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRAEYVSITDNEAMDAFKQLCRAEGIIPALESSHALAHALKM
IHAEPEKEQLIVVNLSGRGDKDIFTVHDILTAQGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgttactgaatccctactttggcgaatttggcggaatgtatgttccgcaaatcctg
atgccagccctgcgccagctggaacaggcgtttgtcgacgcccagaaagatcccgagttt
caggccgaatttaccgacctgctgaagaactacgcgggccgtcctactgccctgacgctg
tgtaaaaatctgacgaaaggcaccaaaacccgcctctatctcaagcgtgaagatctgctg
cacggtggcgcgcataaaaccaaccaggtgctgggtcaggcgctgttagccaaacgcatg
ggcaaaaacgaaatcattgccgagaccggtgccggtcagcatggcgtcgcttctgcgctg
gcctgtgcgctgctgggcatgaaatgccgcatctatatgggcgcgaaagatgtcgagcgt
cagtcccctaacgtgttccgtatgcgtctgatgggcgcagaagtgatcccggttcacagc
ggctccgccacgctgaaagatgcctgtaacgaagcgctgcgtgactggtcaggcagctat
gagacctcacactacatgctcggcactgcggcgggtccgcatcccttcccgactatcgtg
cgtgagttccagcgcatgattggtgaagagaccaaaaagcagattctggaaagagaaggc
cgcctgcccgatgcgatcctcgcctgcgtaggcggcggttcaaatgccatcgggatgttt
gccgactttatcgatgaaaccagcgtgaagctgatcggcgttgagcctgcgggtcacggc
attgaaaccggcgagcatggcgcaccgcttaaacatggtcgcgtcggcatctacttcggt
atgaaatcgccgatgatgcagacccacgatggccagattgaggagtcttattccatctct
gccggcctcgacttcccatcggtcggtccgcagcatgcgcatctgaacagcattggtcgc
gcggagtatgtctccattaccgataatgaagcgatggacgcctttaaacagctgtgtcgc
gcagaagggattattccggcgctggagtcttctcacgccctggcgcacgccctgaagatg
attcacgctgaaccagaaaaagagcagttgattgtggtcaacctctctggccgcggcgac
aaagatattttcaccgttcatgacattctgacagcgcagggagaaatctga

DBGET integrated database retrieval system