KEGG   Pantoea vagans: Pvag_1509Help
Entry
Pvag_1509         CDS       T01326                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha protein (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pva  Pantoea vagans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pvag_1509 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pvag_1509 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pvag_1509 (trpA)
Enzymes [BR:pva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pvag_1509 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1593854..1594657
Genome map
AA seq 267 aa AA seqDB search
MERYNQLFTRLSANKEGAFVPFVTLGDPSPELSLRVIDALVEGGADALELGIPFSDPLAD
GPTIQNATLRAFAAGTNTSQCFEMLATIRRKYPDLPIGLLMYANLVFTNGVDEFYARCAE
AGVDSVLVADVPVEESAPFRQAALRHGVAPIFICPPNASDELLREIASHGRGYTYLLSRA
GVTGAENRASLPLKHLIDKLREYHAAPPLQGFGISEPEQVKEAIAAGAAGAISGSAIVRI
IEKHHAEPEVMLSELKNFVSRLKAASR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttataatcaactgtttacgcggctgtcagcgaataaagaaggcgctttcgtt
cctttcgttacgctgggcgatccctctccggagctttcactgcgcgtgattgacgcgctg
gtggaaggtggcgcagatgcactggagctgggtattcccttctccgatccgctggcagat
ggcccgaccattcagaacgcgacgctgcgcgcctttgcggcgggcaccaacaccagccag
tgttttgaaatgctggcgactatccgccgtaaatacccggatctgccgattggcttgcta
atgtacgctaacctggtcttcaccaacggcgtggatgagttctatgcccgttgtgctgaa
gccggtgtggattcagtgctggtggcggatgtgccggttgaagagtctgcgcccttccgt
caggcagcgctgcgtcatggtgtcgcacccatctttatctgtccgcctaacgccagcgat
gagctgctgcgtgagatcgcgtcgcacggacggggttacacctatctgctgtcacgcgcg
ggtgtgaccggtgctgaaaaccgcgccagcctgccgctgaagcatctgatcgacaagctg
cgtgaataccacgccgcgccaccgctgcagggctttggtatttcagaaccggaacaggtg
aaggaggcgatcgctgccggtgcagcgggcgctatctccggctctgcgattgtcagaatc
attgaaaaacaccatgcagagcctgaggtcatgctgagtgaactgaagaattttgtcagc
cgcctcaaggccgccagccgttaa

DBGET integrated database retrieval system