KEGG   Pantoea vagans C9-1: Pvag_1509Help
Entry
Pvag_1509         CDS       T01326                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00260  Glycine, serine and threonine metabolism
pva00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01130  Biosynthesis of antibiotics
pva01230  Biosynthesis of amino acids
Module
pva_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pvag_1509 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pvag_1509 (trpA)
Enzymes [BR:pva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pvag_1509 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ADO09699
UniProt: E1SER7
Position
1593854..1594657
Genome map
AA seq 267 aa AA seqDB search
MERYNQLFTRLSANKEGAFVPFVTLGDPSPELSLRVIDALVEGGADALELGIPFSDPLAD
GPTIQNATLRAFAAGTNTSQCFEMLATIRRKYPDLPIGLLMYANLVFTNGVDEFYARCAE
AGVDSVLVADVPVEESAPFRQAALRHGVAPIFICPPNASDELLREIASHGRGYTYLLSRA
GVTGAENRASLPLKHLIDKLREYHAAPPLQGFGISEPEQVKEAIAAGAAGAISGSAIVRI
IEKHHAEPEVMLSELKNFVSRLKAASR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttataatcaactgtttacgcggctgtcagcgaataaagaaggcgctttcgtt
cctttcgttacgctgggcgatccctctccggagctttcactgcgcgtgattgacgcgctg
gtggaaggtggcgcagatgcactggagctgggtattcccttctccgatccgctggcagat
ggcccgaccattcagaacgcgacgctgcgcgcctttgcggcgggcaccaacaccagccag
tgttttgaaatgctggcgactatccgccgtaaatacccggatctgccgattggcttgcta
atgtacgctaacctggtcttcaccaacggcgtggatgagttctatgcccgttgtgctgaa
gccggtgtggattcagtgctggtggcggatgtgccggttgaagagtctgcgcccttccgt
caggcagcgctgcgtcatggtgtcgcacccatctttatctgtccgcctaacgccagcgat
gagctgctgcgtgagatcgcgtcgcacggacggggttacacctatctgctgtcacgcgcg
ggtgtgaccggtgctgaaaaccgcgccagcctgccgctgaagcatctgatcgacaagctg
cgtgaataccacgccgcgccaccgctgcagggctttggtatttcagaaccggaacaggtg
aaggaggcgatcgctgccggtgcagcgggcgctatctccggctctgcgattgtcagaatc
attgaaaaacaccatgcagagcctgaggtcatgctgagtgaactgaagaattttgtcagc
cgcctcaaggccgccagccgttaa

DBGET integrated database retrieval system