KEGG   Pantoea vagans: Pvag_1532Help
Entry
Pvag_1532         CDS       T01326                                 

Gene name
adhE
Definition
alcohol / acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pva  Pantoea vagans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pvag_1532 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_1532 (adhE)
   00620 Pyruvate metabolism
    Pvag_1532 (adhE)
   00650 Butanoate metabolism
    Pvag_1532 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    Pvag_1532 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pvag_1532 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pvag_1532 (adhE)
   00626 Naphthalene degradation
    Pvag_1532 (adhE)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pvag_1532 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Pvag_1532 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1612256..1614943
Genome map
AA seq 895 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYANFSQQQVDAIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLATDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDIIGWIDAPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADVKRAVASILMSKTF
DNGVICASEQSVIVVDSVYDAVRERFASHGGYMLQGAELSAVQNIILKNGGLNAAIVGQP
AFKIAEMAGLSVPPSTKILIGEVKLVDESEPFAHEKLSPTLAMYRAKDFQDAVDKAEKLV
AMGGIGHTSCLYTDQDNQTERVHYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINTKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRFLFNNGYADQVTRVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKARMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPRSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKENLPASYAEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIEKLLAWLDEIKTELGIPTSIREAGVQEADFLAKVDKLADDAFDDQ
CTGANPRYPLIAELKQIMLDTYYGREFVEPFSSVAEAVAEQPVKGVKVDKKVKKV
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaccaatgtcgctgaactcaatgcactggtcgaacgtgtaaaaaaagcccag
cgtgaatatgccaacttttctcaacaacaggtcgacgccatcttccgtgccgccgccctt
gccgccgcagacgcccgaatcccgctagctaagatggccgttgccgaatccggtatgggc
atcgtcgaagacaaagtcattaaaaaccactttgcttctgagtatatctacaacgcctat
aaagatgaaaagacctgtggcgtgttggccactgatgatacgttcggtactattaccatc
gccgagccgattggcctgatttgcggtatcgtcccgaccaccaacccaacctcaaccgcc
atcttcaaagcgttaatcagtcttaaaacccgtaacggcattatcttttcgccccaccca
cgcgccaaagacgcaacaaacaaagctgccgatatcgtcttacaggccgccattgctgcc
ggtgcgcctaaagacattatcggctggatcgatgccccgtctgttgagctgtcaaaccag
ctgatgcatcaccctgacatcaacctgattctcgccaccggcggtccgggcatggtgaaa
gcggcatacagctccggtaaaccggcgattggtgtcggtgccggtaacacgccggtagta
atcgatgaaactgccgatgtgaagcgtgccgttgcctccattctgatgtcgaaaaccttt
gataatggggtgatctgcgcctctgaacaatctgtcattgtggttgattcagtttatgac
gccgtgcgtgaacgtttcgccagccatggcggctacatgctgcagggtgctgaactgagc
gctgtacagaatatcatcctgaaaaatggcggcctgaatgcggccatcgtgggtcagcct
gccttcaaaattgcagagatggcgggtctcagcgtgccaccgagcactaagatcctgatt
ggtgaggtaaaactggtggatgagtctgagccattcgcccacgaaaaactctcacctacc
ctcgcgatgtatcgggcaaaagatttccaggatgccgtagataaagcggagaaactggtc
gccatgggcggtatcggtcacacctcctgcctttacaccgaccaggataaccagactgag
cgcgtgcactacttcggcgacaaaatgaaaaccgcgcgtattctgatcaacacccctgcc
tctcagggcggtatcggtgacctctacaactttaaactggcgccgtctctgacgctgggt
tgtggttcctggggcggtaactctatttcagagaacgtcggtccaaaacacctgatcaat
accaaaactgtcgccaagcgagctgagaatatgttgtggcataaacttcctaaatccatc
tacttccgtcggggttccctgccaattgcgctggaagaagtggcaacggacggcgcgaaa
cgtgcctttatcgtcactgaccgcttcctgttcaataacggttatgctgaccaggtgacc
cgcgtgctgaaatcacacggcatcgagactgaagtgttcttcgaagttgaagctgaccca
acgctgagcatcgtacgcaaaggtgcagagcagatgaacagctttaaacctgacgtcatc
attgcgctgggcggcggttccccaatggatgccgcgaaaatcatgtgggtgatgtacgaa
catccggaaacccacttcgaagagctggcattacgtttcatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtcaaagcacgcatggttgccattacgactacctcaggt
accggttcagaagtcacaccgttcgctgtggtgaccgatgatgcgaccggtcagaaatat
cctctggctgactatgcattgacgccggatatggcgattgtcgatgccaacctggtgatg
gatatgccgcgttcactctgcgccttcggtggtctggatgcggtaacccacgcgctggaa
gcctatgtttccgtgctggcaaatgaatactctgatggtcaggcgctgcaggcactgaaa
ctgctgaaagagaacctgccggccagctatgccgaaggtgctaaaaacccggtggcgcgt
gaacgcgttcacaatgccgcgactatcgccggtattgcgtttgccaacgccttcctcggg
gtctgtcactcaatggcacacaaactgggttcagagttccatatcccacacggtctggcg
aatgccctgttaatctcgaacgttattcgctacaacgcgaatgacaacccgaccaaacag
accgcgttcagccagtatgatcgtccacaggcgcgccgtcgttacgctgagattgctgac
cacttaggtctgagcgcaccgggcgaccgcaccgcgcagaaaattgagaagctactggca
tggctggacgagatcaaaactgaactcggtattccgacctcaatccgcgaagccggtgtg
caggaagcggacttcctggcgaaagtcgacaaactggccgatgatgcgttcgatgaccag
tgtactggcgcgaacccacgctatccgctgattgctgagctgaaacagattatgctcgat
acctactacggacgtgaatttgtcgaaccgttctcaagtgtcgccgaagccgtagctgag
cagccggtaaaaggcgtgaaagttgataagaaagtgaaaaaagtctga

DBGET integrated database retrieval system