KEGG   Pantoea vagans: Pvag_1549Help
Entry
Pvag_1549         CDS       T01326                                 

Gene name
ydjB
Definition
pyrazinamidase / nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pva  Pantoea vagans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Pvag_1549 (ydjB)
Enzymes [BR:pva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Pvag_1549 (ydjB)
    3.5.1.-  
     Pvag_1549 (ydjB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1631314..1631922
Genome map
AA seq 202 aa AA seqDB search
MKRALIIIDIQNDFCPGGPMAVHEGDHTVEVANRYARLFRENGECVLALQDWHPADHGSF
ASVSGEPVYTLGELNGLAQIWWPDHGIQGSAGADFHPGLDRSLFDATFHKGEDQDVDSYS
AFFDNGHRRKTELDSWLRERGITHLVMLGLATDYCVKYSVLDALELGYHVEVVKEGCRGV
NLNPDDSEIAFAQMTAQGAILI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggcactcatcattattgatattcagaacgatttttgccccggcggcccgatg
gcagtccatgagggcgaccacacggtcgaggtggccaatcgctatgcgcggctgttccgt
gaaaacggtgaatgcgtactggccctgcaggactggcacccggccgatcacggcagcttt
gcctcggtttccggtgagccggtctacacactgggcgagttaaatggtctggcgcaaatc
tggtggcccgatcacggcattcagggctcagcaggtgcggacttccatcccggtctggat
cgttcactgttcgatgcgacgttccataaaggtgaagatcaggatgtcgacagctacagc
gccttttttgataatggccaccgtcgtaaaaccgagctggatagctggctacgtgagcgt
ggcatcacccatctggtgatgctggggctggcgacagattactgcgtgaaatatagcgtg
ctggatgcgctggaattggggtatcacgtcgaggtggtcaaagaaggctgccgcggcgtc
aatctgaatcctgatgacagtgaaatcgcctttgctcagatgacggctcagggcgcgatt
ctgatttaa

DBGET integrated database retrieval system