KEGG   Pantoea vagans: Pvag_1623Help
Entry
Pvag_1623         CDS       T01326                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pva  Pantoea vagans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pvag_1623 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_1623 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    Pvag_1623 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pvag_1623 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pvag_1623 (adhP)
   00626 Naphthalene degradation
    Pvag_1623 (adhP)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pvag_1623 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1705040..1706062)
Genome map
AA seq 340 aa AA seqDB search
MKAAIANSEHQVEVVEKTLRPLKTGEARLRMECCGVCHTDLHVKNGDFGDKTGVTLGHEG
IGIVEEVAPDVTSLKPGDRASVAWFFKGCGHCEYCNSGNETLCRDVINAGYTADGGMAEE
CIVVADYSVKVPDGLDPFAASSVTCAGVTTYKAVKVSEVKPGQWLAIYGLGGLGNLALQY
AKNVFNAKVIAIDVSDGQLALAKEMGADLVVNSASEDAARFIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLNIPRLVLDGIQVVGSLVGTRNDLSEAFQFAAEG
KVVPKVTKRKIGEVNAIFDEMIHGKIRGRMVIDFTGQPAS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcaattgctaatagtgaacaccaggttgaagtggttgagaagacgctgcgt
cctctcaaaaccggcgaagcgcggctcaggatggaatgctgtggtgtatgccataccgat
ttgcatgtgaagaacggtgattttggtgacaagaccggcgtcacgctgggtcatgaaggg
atcggcatcgttgaggaggtcgcgccggatgtcacctcgctcaagccgggcgatcgcgcc
agcgtcgcctggttcttcaagggctgcgggcactgtgaatattgtaattccggtaacgaa
acgctctgcagagacgtcatcaatgccggttataccgccgatggcggtatggctgaagag
tgtattgttgttgcagattactcggttaaagttcccgatgggctcgatcctttcgccgcc
agtagcgtcacctgcgccggtgtcactacgtataaagcggtaaaagtatcagaggttaaa
ccggggcagtggctggcaatttatggccttggcgggctgggtaacctggcgctgcaatat
gctaaaaacgtcttcaatgccaaagtgattgcgattgatgtcagtgacggacagctggcg
ctggcgaaagagatgggtgccgatctggtcgtcaactctgccagcgaagatgcggcacgc
tttattcaggagaaaaccggtggggcgcatgcggctgtggttacagccgtcgccaaagcg
gcctttaactcggcggtggatgcggtcagagccggaggtcgggttgtagcagtcggactg
ccgccggaagcgatgagcctgaatatcccgcgactggtgctcgatggcatccaggtggtg
ggatcgctggtcggaacgcgcaacgatctgtcggaagcgttccagtttgcggcagaaggc
aaggtggtgcctaaggtaactaaaaggaagattggtgaggtcaatgccatcttcgatgag
atgattcacggcaaaatccgcggcaggatggtgatcgactttaccggtcagcctgccagt
tag

DBGET integrated database retrieval system