KEGG   Pantoea vagans: Pvag_1973Help
Entry
Pvag_1973         CDS       T01326                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pva  Pantoea vagans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pvag_1973 (galF)
   00052 Galactose metabolism
    Pvag_1973 (galF)
   00500 Starch and sucrose metabolism
    Pvag_1973 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    Pvag_1973 (galF)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pvag_1973 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2069429..2070331)
Genome map
AA seq 300 aa AA seqDB search
MTKLKAVIPVAGLGMHMLPATKAIPKEMLPVVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTTYELEALLEARVKRQLLSEVQSICPPGVTIMNVRQAQPLGLGHSILCARPM
IGDNPFVVVLPDVLLDDSTADHMRYNLAAMVARFEETGHSQVLAQHMPASDLSEYSVITT
EEPIDHPGDISTITDFVEKPEDTAGLSSDLAAVGRYVLSADIWAELERTEPGAWGRIQLT
DAIASLSKHKTVDVSLLTGHSFDCGRKLGYMQAFVSYGLRNNAQGRDFREAIQTILAKQK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcttaaagcagtaatcccggttgcgggcctcggtatgcatatgctccctgcg
actaaagccattccgaaagagatgctgcctgtcgtcgacaaaccgatgatccagtacatc
attgacgagtgtgttgccgcaggtattaaagagattgtgctggtcacgcatgcatcgaaa
aatgccgttgaaaaccacttcgacaccacctatgagctggaagcgctgcttgaagcgcgc
gtgaagcgtcagctgctgagcgaagtgcagtctatctgcccgccaggcgtcaccatcatg
aacgtgcgccaggcgcagccactgggtctgggccactccattctctgtgcccgtccgatg
atcggtgataacccgttcgtggtggtgctgccggacgtcctgctggatgactctaccgct
gaccacatgcgttataacctcgcagcgatggttgcccgttttgaagagaccggccacagc
caggtcctggcgcagcatatgccagcttccgatctctctgagtactctgtgatcaccacg
gaagagccgatcgatcacccaggcgacatcagcaccatcaccgatttcgttgagaagcct
gaagatacagccggactgagctctgacctggctgcggtaggccgctatgtgctttctgct
gatatctgggcagaactggagcgcactgagccaggcgcgtggggccgtatccagctgacc
gatgcgatcgccagcctgagcaagcacaaaaccgttgatgtctctctgctgactggtcac
agtttcgactgcggtcgtaaactgggttacatgcaggcgttcgtctcttacggactgcgc
aacaacgcgcagggtcgcgatttccgcgaagctatccagacgattctcgcaaaacaaaag
taa

DBGET integrated database retrieval system