KEGG   Pantoea vagans: Pvag_2148Help
Entry
Pvag_2148         CDS       T01326                                 

Gene name
fadJ
Definition
fatty oxidation complex, subunit alpha (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pva  Pantoea vagans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pvag_2148 (fadJ)
   01212 Fatty acid metabolism
    Pvag_2148 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pvag_2148 (fadJ)
   00650 Butanoate metabolism
    Pvag_2148 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    Pvag_2148 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    Pvag_2148 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pvag_2148 (fadJ)
   00310 Lysine degradation
    Pvag_2148 (fadJ)
   00380 Tryptophan metabolism
    Pvag_2148 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pvag_2148 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pvag_2148 (fadJ)
   00281 Geraniol degradation
    Pvag_2148 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Pvag_2148 (fadJ)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pvag_2148 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pvag_2148 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pvag_2148 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2289548..2291572)
Genome map
AA seq 674 aa AA seqDB search
MEQNAFHLKMRLDHVGIITIDVPGEKMNTLKAEFAGQITAIIAEARRDPQLAGLVLISGK
ADNFIAGADISMIDRCQSAQKAEALAKQGQEVMAALDALPFPVVAAIHGACLGGGLELAL
ACDARICSLDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVQQALPLILTGKTLRAKQARK
LGVVDDAVPQAILLETAIARVKKGKVSGRTLPLRDRLLHGPVGRQALFALATRQTAAKTQ
GNYPAAKRIIEVMRIGLEQGSRAGHDAEARAFGELAMTPESVALRGIFFATTAMKKERGG
EAEPAAVKRVAILGGGLMGGGIASVTAINAGLPVRIKDISLEGVNHALKTSWELLSKKVK
RRQLTPAQRQQQMARITGGIDYQDFSQRDVVIEAVFEDLALKQQMVSEVEAHCQPHTLFA
SNTSSLPIEEIAAKAQRPENVIGLHYFSPVDKMPLVEVIPHLNTSTATVVTIVALARSQG
KTPIVVADKPGFYVNRILTPYINEAMRCLLEGEPIDHIDRALVKAGFPVGPIQLLDEVGI
DVGSKISPILHQAYGERFAAPAAFDAVLKDGRKGRKNSKGFYRYDQPRWQRKKPDTSLYT
LLKVTPQARQSEAQIAERCMMMMLNEAARCLDEQVIRCARDGDIGAVFGIGFPPFLGGRS
TIWTNWVRRRWSTD
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaatgcgtttcacctgaagatgcgactggatcacgttggcatcattacaatc
gatgtccctggcgagaagatgaacaccctgaaagcagaatttgccgggcagattaccgcc
atcattgcggaggcgcgacgcgatcctcagctggcaggactggtgctgatttctggcaaa
gcggacaactttatcgcgggcgccgacatcagcatgattgatcgctgtcagagcgcgcag
aaagccgaagcgctggcaaaacaggggcaggaagtgatggctgcgcttgatgcgctgcca
ttcccggtagtggccgcaatccatggtgcctgtctgggcggcgggctggaactggcgctg
gcctgcgatgcgcgcatctgctcgcttgatgataaaacccgtctcggattaccggaagtg
caactcggcttactgcccggctccggtggcactcagcgactgccgcggttaattggcgtg
cagcaggcgctgccgctgattctgaccggcaaaacgctgcgggcgaaacaggcacgtaag
ctgggagtggtcgatgacgcggtacctcaggcgattttgctggagacggctatcgcacgg
gtgaaaaagggcaaagtcagcggtcgaacgctgccgctgcgcgaccgtctgctgcacggt
ccggtgggccgtcaggcgctgtttgcactggcgacccggcagacagcagctaaaacccag
ggtaactatccggcagcaaaacgcattattgaggtgatgcgcatcgggctggagcagggc
agccgggcaggacatgatgccgaagcacgcgcttttggtgaactggcgatgacgccagaa
tctgttgctttgcgcgggatctttttcgcgaccaccgccatgaagaaggagcggggtggt
gaggcggaacccgctgcggtgaagcgtgtcgcgattctcggcggcggtctgatgggcggt
ggcatcgccagcgtcaccgcaatcaatgccgggttgccggtgcgcatcaaagatatcagc
ctggaaggcgttaaccatgcgctgaaaaccagctgggaactgctgagcaaaaaggtcaaa
cgacgccagctcactccggcacagcgtcagcagcagatggcccggatcacgggcggcatc
gattatcaggatttctcacagcgcgatgtggtgatcgaagccgtgttcgaagatttagca
ctcaagcagcagatggtcagtgaagtggaagcccactgtcagccgcatacgctgtttgct
tctaacacctcttcgctgccgattgaagagattgccgccaaagcacagcgtccggagaac
gtcatcgggctgcactacttcagcccggtcgataaaatgccgctggtggaagtgattccc
catctgaacacctccaccgcaacggtggtgacgattgtggcgctggcgcgcagccagggc
aaaacgccgatagtggtggcggacaagcctggcttctatgttaaccgcatcctgacgcct
tatataaatgaagcgatgcgttgcctgctggagggcgagccgattgaccatatcgatcgg
gcgctggtgaaggctggttttccggtcggtccgattcagctgctggatgaggtaggcatc
gacgtcggcagcaaaatcagtcccatcctgcatcaggcttatggtgaacgctttgccgcg
cccgctgcttttgatgcagtgctgaaagatggccgcaagggtcgtaaaaatagcaaaggc
ttctatcgctatgaccagccgcgctggcagcgtaaaaagccggacacctcactgtatacg
ttactgaaggtcacgccgcaggccaggcagagcgaagcgcagattgcggaacgctgcatg
atgatgatgctgaacgaggcggcacgctgccttgatgagcaggtcattcgctgtgcccgc
gatggcgatatcggtgcagtgtttggtatcggctttccgcctttcctggggggccgttcc
actatatggacaaactgggtgcggcggaggtggtcaaccgattaa

DBGET integrated database retrieval system