KEGG   Pantoea vagans C9-1: Pvag_2148Help
Entry
Pvag_2148         CDS       T01326                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00071  Fatty acid degradation
pva00280  Valine, leucine and isoleucine degradation
pva00281  Geraniol degradation
pva00310  Lysine degradation
pva00362  Benzoate degradation
pva00380  Tryptophan metabolism
pva00410  beta-Alanine metabolism
pva00640  Propanoate metabolism
pva00650  Butanoate metabolism
pva00903  Limonene and pinene degradation
pva00930  Caprolactam degradation
pva01040  Biosynthesis of unsaturated fatty acids
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01120  Microbial metabolism in diverse environments
pva01130  Biosynthesis of antibiotics
pva01200  Carbon metabolism
pva01212  Fatty acid metabolism
Module
pva_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pvag_2148 (fadJ)
   00650 Butanoate metabolism
    Pvag_2148 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    Pvag_2148 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    Pvag_2148 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pvag_2148 (fadJ)
   00310 Lysine degradation
    Pvag_2148 (fadJ)
   00380 Tryptophan metabolism
    Pvag_2148 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pvag_2148 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pvag_2148 (fadJ)
   00281 Geraniol degradation
    Pvag_2148 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pvag_2148 (fadJ)
   00930 Caprolactam degradation
    Pvag_2148 (fadJ)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pvag_2148 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pvag_2148 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pvag_2148 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADO10328
UniProt: E1SJZ6
Position
complement(2289548..2291572)
Genome map
AA seq 674 aa AA seqDB search
MEQNAFHLKMRLDHVGIITIDVPGEKMNTLKAEFAGQITAIIAEARRDPQLAGLVLISGK
ADNFIAGADISMIDRCQSAQKAEALAKQGQEVMAALDALPFPVVAAIHGACLGGGLELAL
ACDARICSLDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVQQALPLILTGKTLRAKQARK
LGVVDDAVPQAILLETAIARVKKGKVSGRTLPLRDRLLHGPVGRQALFALATRQTAAKTQ
GNYPAAKRIIEVMRIGLEQGSRAGHDAEARAFGELAMTPESVALRGIFFATTAMKKERGG
EAEPAAVKRVAILGGGLMGGGIASVTAINAGLPVRIKDISLEGVNHALKTSWELLSKKVK
RRQLTPAQRQQQMARITGGIDYQDFSQRDVVIEAVFEDLALKQQMVSEVEAHCQPHTLFA
SNTSSLPIEEIAAKAQRPENVIGLHYFSPVDKMPLVEVIPHLNTSTATVVTIVALARSQG
KTPIVVADKPGFYVNRILTPYINEAMRCLLEGEPIDHIDRALVKAGFPVGPIQLLDEVGI
DVGSKISPILHQAYGERFAAPAAFDAVLKDGRKGRKNSKGFYRYDQPRWQRKKPDTSLYT
LLKVTPQARQSEAQIAERCMMMMLNEAARCLDEQVIRCARDGDIGAVFGIGFPPFLGGRS
TIWTNWVRRRWSTD
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaatgcgtttcacctgaagatgcgactggatcacgttggcatcattacaatc
gatgtccctggcgagaagatgaacaccctgaaagcagaatttgccgggcagattaccgcc
atcattgcggaggcgcgacgcgatcctcagctggcaggactggtgctgatttctggcaaa
gcggacaactttatcgcgggcgccgacatcagcatgattgatcgctgtcagagcgcgcag
aaagccgaagcgctggcaaaacaggggcaggaagtgatggctgcgcttgatgcgctgcca
ttcccggtagtggccgcaatccatggtgcctgtctgggcggcgggctggaactggcgctg
gcctgcgatgcgcgcatctgctcgcttgatgataaaacccgtctcggattaccggaagtg
caactcggcttactgcccggctccggtggcactcagcgactgccgcggttaattggcgtg
cagcaggcgctgccgctgattctgaccggcaaaacgctgcgggcgaaacaggcacgtaag
ctgggagtggtcgatgacgcggtacctcaggcgattttgctggagacggctatcgcacgg
gtgaaaaagggcaaagtcagcggtcgaacgctgccgctgcgcgaccgtctgctgcacggt
ccggtgggccgtcaggcgctgtttgcactggcgacccggcagacagcagctaaaacccag
ggtaactatccggcagcaaaacgcattattgaggtgatgcgcatcgggctggagcagggc
agccgggcaggacatgatgccgaagcacgcgcttttggtgaactggcgatgacgccagaa
tctgttgctttgcgcgggatctttttcgcgaccaccgccatgaagaaggagcggggtggt
gaggcggaacccgctgcggtgaagcgtgtcgcgattctcggcggcggtctgatgggcggt
ggcatcgccagcgtcaccgcaatcaatgccgggttgccggtgcgcatcaaagatatcagc
ctggaaggcgttaaccatgcgctgaaaaccagctgggaactgctgagcaaaaaggtcaaa
cgacgccagctcactccggcacagcgtcagcagcagatggcccggatcacgggcggcatc
gattatcaggatttctcacagcgcgatgtggtgatcgaagccgtgttcgaagatttagca
ctcaagcagcagatggtcagtgaagtggaagcccactgtcagccgcatacgctgtttgct
tctaacacctcttcgctgccgattgaagagattgccgccaaagcacagcgtccggagaac
gtcatcgggctgcactacttcagcccggtcgataaaatgccgctggtggaagtgattccc
catctgaacacctccaccgcaacggtggtgacgattgtggcgctggcgcgcagccagggc
aaaacgccgatagtggtggcggacaagcctggcttctatgttaaccgcatcctgacgcct
tatataaatgaagcgatgcgttgcctgctggagggcgagccgattgaccatatcgatcgg
gcgctggtgaaggctggttttccggtcggtccgattcagctgctggatgaggtaggcatc
gacgtcggcagcaaaatcagtcccatcctgcatcaggcttatggtgaacgctttgccgcg
cccgctgcttttgatgcagtgctgaaagatggccgcaagggtcgtaaaaatagcaaaggc
ttctatcgctatgaccagccgcgctggcagcgtaaaaagccggacacctcactgtatacg
ttactgaaggtcacgccgcaggccaggcagagcgaagcgcagattgcggaacgctgcatg
atgatgatgctgaacgaggcggcacgctgccttgatgagcaggtcattcgctgtgcccgc
gatggcgatatcggtgcagtgtttggtatcggctttccgcctttcctggggggccgttcc
actatatggacaaactgggtgcggcggaggtggtcaaccgattaa

DBGET integrated database retrieval system