KEGG   Pantoea vagans C9-1: Pvag_2229Help
Entry
Pvag_2229         CDS       T01326                                 

Gene name
dapE
Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00300  Lysine biosynthesis
pva01100  Metabolic pathways
pva01120  Microbial metabolism in diverse environments
pva01230  Biosynthesis of amino acids
Module
pva_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pvag_2229 (dapE)
Enzymes [BR:pva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Pvag_2229 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M18 Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ADO10402
UniProt: E1SKM5
Position
2372166..2373293
Genome map
AA seq 375 aa AA seqDB search
MFCPVIELTQQLIRRPSLSPDDAGCQALLIARLEAIGFKIETMNIDDTLNFWATRGEGET
LAFAGHTDVVPPGDASRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAVRPN
HRGRLAFMITSDEEASGTNGTVKVVERLMARRERLDYCLVGEPSSTEVVGDVVKNGRRGS
ITANLTVHGVQGHVAYPHLADNPVHRAMPALTELVATEWDQGNEFFPATSMQIANVQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIRQRVAELLDRHQLRYTIEWKLSGQPFLTSRGKL
VDAVVKAVAHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVKASDLQ
MLSRMYQRIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcccggtcattgagctgacgcagcagcttattcgtcgcccctctctcagcccc
gatgatgccggatgtcaggctctgctgatcgcccgtcttgaagccattggctttaagatt
gaaacgatgaacatcgacgacaccctgaatttctgggccacccgtggcgaaggtgaaacg
ctggcgtttgccggtcataccgatgtggtgccgcctggcgatgccagccgctggattaac
ccgccctttgaaccgacgatccgcgatggcatgctgtttggccgtggcgcggctgacatg
aaagggtcactggcggccatggtggtggccgccgaacgttttgtggcggtgcgtcccaat
catcggggccgcctcgcctttatgattacctctgatgaagaggccagcgggaccaacggc
acggttaaagtggttgaacggctgatggcgcgccgtgaaaggcttgactattgcctggtc
ggcgagccgtccagcacggaagtcgtcggtgacgtggtgaagaatggccgacgcggctca
attaccgccaacctgacggtgcacggtgtgcagggccacgtcgcctatccgcatctggcg
gataacccggttcaccgggcgatgcctgcgctgacggagctggtcgcgacggagtgggat
cagggaaatgagttcttcccggccaccagcatgcagattgcgaatgtccaggcgggcacc
ggcagcaacaatgtgatccccggcgagctgtttgtgcagttcaacttccgcttcagcact
gaactcaccgatgagatgatccgccagcgggtcgcggaactgctggatcgtcaccagctg
cgttacaccatcgagtggaaactctcgggtcagcccttcctgacctcgcgcggtaagctg
gtggatgccgtcgtgaaagctgtggcgcactataatgaaattaagccgcagctgctgact
acaggcggcacctccgatggccggtttatcgcccggatgggggcgcaggtggtggagctg
gggccggtgaatgccaccattcacaaaatcaatgagtgtgtgaaagcctccgacctgcag
atgctgagccggatgtaccagcgcatcatggaacaactgatcgcctga

DBGET integrated database retrieval system