KEGG   Pantoea vagans C9-1: Pvag_2439Help
Entry
Pvag_2439         CDS       T01326                                 

Gene name
pcm
Definition
(GenBank) L-isoaspartate protein carboxylmethyltransferase type II
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pva  Pantoea vagans C9-1
Brite
Enzymes [BR:pva01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pvag_2439 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_23 DREV CMAS
Motif
Other DBs
NCBI-ProteinID: ADO10603
UniProt: E1SC13
Position
complement(2604801..2605427)
Genome map
AA seq 208 aa AA seqDB search
MVNRRIETLLSQLRQQGIDDENLLKAISEVPRERFIDEAFEHKAWDNVALPIGSGQTISQ
PYMVARMTALLGLNPHSRVLEIGTGSGYQTAILAHLVDHVYSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWQGWPSRGPFDAIIVTAAPPEIPIALIAQLAEGGIMVLPVGEDQQVLK
RLRRQGEEVTEEIIEPVRFVPLVQGDLA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatcggcgtattgagacactgctgtcacaactgcgtcagcagggtattgatgat
gaaaacctgctgaaagccatcagcgaggtgccacgcgaacggtttatcgacgaggcgttt
gagcataaagcctgggacaatgtggccttgcctatcggctccggtcagacgatttcacag
ccttatatggtcgcgcggatgaccgcgttgctcgggctgaatccgcattcgcgtgtactg
gagattggtacgggttccgggtatcagacagcgattcttgcccatctggtcgaccatgtc
tattcagtggaacgcatcaaagggctgcaatggcaggccaaacgccgtctgaaacagctg
gatctgcataatgtctcaacccgccatggcgatggttggcagggctggccatctcgcggt
ccgttcgatgccatcattgttaccgccgctccaccggaaattccgattgcgctgatagca
caactggcagaaggcggcattatggtgctgccggttggcgaagatcagcaggtactgaag
cgcctgcgccgtcagggcgaagaggtcacggaagagatcattgaaccggtgcgttttgtt
ccgctcgtacagggcgatctcgcctga

DBGET integrated database retrieval system