KEGG   Pantoea vagans: Pvag_2517Help
Entry
Pvag_2517         CDS       T01326                                 

Gene name
dsbC
Definition
protein disulfide isomerase II (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pva  Pantoea vagans
Brite
Enzymes [BR:pva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Pvag_2517 (dsbC)
Secretion system [BR:pva02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Pvag_2517 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2689894..2690607)
Genome map
AA seq 237 aa AA seqDB search
MNKHFAMLALLASAFSGLAQADDSAIQQSLKKLGLNQTEISPSPLPGFKTVLSESGVLYV
TDDGKHMIQGPLYDVSGKQPVNVTNQLLDKKVEALVPEMIVYKAPKEQHVITVFTDITCG
YCHKLHEQMADYNALGITVRYLAFPREGLNGQIEPAMKAIWCSADRNKAFDEAMKGNAPK
MAAPDSCKIDIAQHYKLGVLFGIQGTPAMLTDTGMMIPGYQSPQELKQVLDNQKRGG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcattttgccatgctggccctgttagccagcgccttttccggtctggcacag
gccgatgacagcgccattcagcaatctcttaaaaagctcggtttgaaccagacggagatc
agcccgtcaccgctgccgggatttaaaaccgtgctgtcggaaagcggcgtgctctatgtg
accgatgacggcaaacatatgattcagggcccgctctatgatgtcagcggcaaacagccg
gtcaacgtcaccaaccagctgctggacaaaaaagtcgaggcgctggtgccggaaatgatc
gtctataaagcgccaaaagagcagcatgtgatcacggtcttcaccgacatcacctgcggc
tactgtcacaagctgcacgagcagatggcagactacaatgcgctgggcatcaccgtgcgc
tacctggcgtttccgcgtgaagggctgaatggtcagatcgaaccagcgatgaaagcgatc
tggtgcagcgctgatcgcaataaagcgttcgatgaggcgatgaaaggcaatgcaccgaaa
atggccgcgccggacagctgcaaaatcgatattgctcagcactacaaactgggcgtgctg
ttcggcattcagggcacgcccgcgatgctgaccgacaccggcatgatgatcccgggttat
cagtcgccgcaggagctgaagcaggtgctggacaatcagaagcgtggtggttaa

DBGET integrated database retrieval system