KEGG   Pantoea vagans: Pvag_2694Help
Entry
Pvag_2694         CDS       T01326                                 

Gene name
nucD
Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pva  Pantoea vagans
Brite
Enzymes [BR:pva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Pvag_2694 (nucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2872566..2873075)
Genome map
AA seq 169 aa AA seqDB search
MNLQIVKRCAVGVVLALAATLPGFQQLHTSVEGLRLIADYEGCRLQPYQCSAGKWTDGIG
NTSGVVPGKSITERQAAGNFITNVLRTEAALARCVAVSMPQQVYDALVSLAFNVGTGNVC
ASTMVTLLKKGQWREACYQLPRWVYVKGVFSQGLDNRRGRELAWCLKGV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcagatcgttaagcgctgcgccgtgggcgtggtgctggcgctggccgccacg
ctgcccggctttcagcagctgcacacctccgtcgaggggctgcggctgattgccgactat
gagggctgccggctgcagccgtaccagtgcagtgcgggaaagtggaccgacgggatcggc
aacacgtccggcgttgtgccgggtaagtccatcacggaacggcaggcggcgggaaatttc
atcaccaacgtgttacgcactgaggcggcactggcgcgctgcgtggcggtctcaatgccg
cagcaggtttatgacgcgctggtgtcgctggcgttcaacgtcggcaccggcaacgtgtgc
gcctccaccatggtgacgttgctgaaaaagggccagtggcgcgaggcgtgttaccagctg
ccgcgctgggtgtacgtaaaaggcgtattcagtcaggggctggataaccggcgcgggcgt
gagctggcctggtgccttaagggagtctga

DBGET integrated database retrieval system