KEGG   Pantoea vagans: Pvag_2771Help
Entry
Pvag_2771         CDS       T01326                                 

Gene name
cysQ
Definition
adenosine 3'-phosphate 5'-phosphosulfate 3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pva  Pantoea vagans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pva00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2950624..2951367)
Genome map
AA seq 247 aa AA seqDB search
MLEQICQLAREAGDAIMQVYNAAAPLDVSHKSDDSPVTAADIAAHNVIMKGLKQLSPEIP
VLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEAGKPVMGVVYAPVL
GVMYAAADGKAWKEEGGQREQIHARDARPPLVVVSRSHGDDAEMKEYLKQLGEHQTVATG
SSLKFCLVAEGKAQLYPRFGPTNIWDTGAGHAVAMAAGAHVHDWQGKTLDYAPRESFLNP
GFRVSLF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaatctgccaactggcacgcgaagcgggcgacgcgattatgcaggtctat
aacgctgccgcgccgcttgacgtttctcacaaatcggacgattcaccggtgaccgctgcg
gatattgcggcgcacaacgttatcatgaagggcctgaagcagttatcgccagagatcccg
gtgctgtcagaagaagatcccccagcctgggaggtgcgtcagcactggcagcgttactgg
ctggtcgatccgctggatggcaccaaagagttcatcaaacgcaacggcgaatttaccgtc
aatattgcactaatcgaagcgggcaagccggtgatgggcgtggtttatgcaccggtgctg
ggcgtcatgtacgccgctgcagacggtaaagcgtggaaagaggagggcggtcagcgtgaa
cagattcatgcccgtgacgcgcgtcctccgctggtcgtggtgagtcgctcacatggcgat
gacgccgagatgaaagagtacctgaaacagctgggtgaacatcagaccgtcgccaccggc
tcttctctgaaattctgcctggtggcggaagggaaagctcagctctatccccgtttcggg
cccaccaacatctgggataccggcgcgggtcatgccgtggcgatggccgctggcgcccat
gtgcatgactggcagggtaaaaccctggactacgcgccgcgcgaatccttccttaatcct
ggcttccgcgtctccttgttttaa

DBGET integrated database retrieval system