KEGG   Pantoea vagans C9-1: Pvag_2956Help
Entry
Pvag_2956         CDS       T01326                                 

Gene name
ycjM
Definition
(GenBank) sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
pva  Pantoea vagans C9-1
Brite
Enzymes [BR:pva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     Pvag_2956 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADO11106
UniProt: E1SGV6
Position
3117536..3119221
Genome map
AA seq 561 aa AA seqDB search
METITDLIEKIYAGTFPEATFARLQADIATAREAIKLPRKAHWDEQDVVLITYADQFREA
GKPTLSTFSRFYQQHLQSTFPLVHLLPFFPWSSDDGFSVIDYHQVDPQCGDWQDIARLHQ
ETRLMFDFVCNHMSSQSAWFRHFLAQDPGWNDFFISMPPATDLSAVTRPRTSPLLTPFKM
ADGDTSFIWTTFSADQIDLNFANPEVLLRMVNVLLDYLIRGADYVRLDAVGYMWKTPGTR
CIHLEKTHQLVKLFRAIADHVAPGTVIITETNVPHQDNISYLGNGHDEAQMVYQFSLPPL
VLHAIHTGSARALRQWASSLDLSSNDTTFFNFLASHDGIGLNPARGILSEVEIVALVRDL
ALEGALVSYKNNPDGTTSPYEINVTYLDALNSEADDDATRLKRFLLAHAILLVFPGVPAI
YIQSILGGRNHYDGVRAAGHNRAINRQKYDLQQIEAALAGSDWLRQQVYTRLGQLIQLRR
RQPAFHPDNPMTIYDSENAVLVLSRHQPESGDGLLCVFNLSGRSVMTQLPVAHTLQDVVS
GEKIDGTQPVKLDAWQFMWLR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgatcaccgatctgattgagaagatttatgctggcacattcccggaggcgacc
tttgcgcgcctgcaggctgatatcgctaccgcccgcgaggcgattaagctgccacgtaag
gcacactgggatgaacaggatgtggtgctgatcacctacgccgatcagtttcgggaagcc
ggtaaacccacgctcagcaccttttcccgtttctatcagcagcatctgcaatccacgttt
ccgctggtccacctgctgcccttttttccctggtcgtccgatgacggcttttcggtgatt
gattatcatcaggtcgatccgcagtgcggcgactggcaggatattgcgcgcctgcatcag
gaaacccggctgatgtttgacttcgtctgcaaccacatgtcgtcgcagagcgcctggttc
cgccactttctggcgcaggatcccggctggaacgatttctttatcagcatgccgcccgcc
accgatctcagtgccgtcacgcgaccgcgcacttcgccgctgctgacgccgtttaagatg
gccgatggcgacaccagctttatctggaccaccttcagcgccgaccagatcgaccttaat
tttgccaatcctgaggtgttgctgcgcatggtcaacgtgctgctcgactacctgatccgt
ggcgctgactatgtacgtctcgatgcggtcggctatatgtggaaaacgcccggcacgcgc
tgtattcatctggaaaaaacccatcagctggtgaagctgtttcgcgccattgccgaccat
gtcgcgcctgggacggtgattatcaccgagaccaacgtgccgcatcaggacaacatcagt
tatctgggcaacgggcacgatgaggcgcagatggtctatcagttttcactgccgccgctg
gtcctgcacgccattcataccggatcggcgcgcgcactgcggcagtgggccagttcgctg
gatctcagcagcaacgacaccaccttcttcaattttctggcatcccacgatggtatcggg
ctgaatccggcacgcggcattttgtcggaggtggagattgtggcgctggtgcgcgatctg
gcgctggaaggcgcgctggtctcctataaaaacaaccccgacggcaccaccagcccctat
gaaatcaacgtcacctatctggatgcgttaaatagcgaagctgacgatgacgccacgcgg
ctgaaacgctttttgctggcccatgcgattctgctggtctttcctggcgtgccggctatc
tatatccagagtattctgggcggtcgtaaccattatgatggcgtacgcgcagccgggcac
aaccgggcgattaaccggcagaagtatgatttgcagcagattgaggcggcgctggcgggc
agtgactggctgcgtcagcaggtttatacccgtcttggccagctgattcagttacgacgt
cgccagcctgcgtttcatcctgataatccgatgacgatctatgacagcgaaaatgccgtg
ctggtgctcagccgtcatcagccagagagcggcgacggactgctgtgcgtgtttaatctc
agtggacggtcagtgatgacgcaactgccggtggcgcatacgttgcaggatgtggtgagc
ggagagaaaattgatggcacccagccggttaagctggatgcctggcagttcatgtggcta
cgttaa

DBGET integrated database retrieval system