KEGG   Pantoea vagans: Pvag_2961Help
Entry
Pvag_2961         CDS       T01326                                 

Gene name
malQ
Definition
glycoside hydrolase, family 77 (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pva  Pantoea vagans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pva00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3121823..3123904)
Genome map
AA seq 693 aa AA seqDB search
MKQNSLDQAARAAGISLDYIDVNGRKEAVSDETKRALLAVMAEPQKASKSPLPPVAVFSG
SSKRQLTAQGSGTYSWQLQTEKGKQHSGELTAGEPFTLPGPLTQGYHQLTLTKGKKSWQT
RVIVAPRRCYLPPALEAGEKRWGALVQLYTVRSEQNWGIGDFGDLDQLLVQLAERGGDFV
GLNPLHALYPASAGFASPYSPSSRRWLNVIYIDVSQVTDFQQSAAAQKWWKSAKTQKALT
KAREAEQVEYEAVMALKLAALRHAWTHFQARDSQSEEPLSFAAFVRDGGDSLRYQAAYDG
IQLERQADKSQQGGWPAWPEAWRNSQSPEVQQWCEQHEQEIAFWQWLQWLAQQQFSGCWA
HSQALGMSVGLYRDLAVGVAEGSAETWHDPELYRLKASVGAPPDRLGPLGQNWGLPPMDP
HVMQARAYQPFIDMLRANMRDCGALRIDHVMSLLRLWWVPAGETADKGAYVAYPVNDLLA
ILSLESHRLRCMVIGEDLGTVPQEIVSLLRKSGVFSWKVLWFEQEKDERYRAPEDYPRQS
IASASTHDLPTLTGFWEQGDLELGEKLGLYPGDAVKALHEQRAAQKQALLDALHQAGALP
ARSQKKAEKLAMTPALNRAIHRFLADTDSALLGLQPEDWLGMTTPVNVPGTVDQYPNWRR
KLSKTLEEIFADKEVNALLKVVSQQRQSGKKEK
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaattcactcgatcaggccgcccgtgccgcaggcatttcactggattacatc
gacgtcaacggcaggaaagaggctgtcagcgatgagaccaaacgcgcactgctggcggtg
atggcagaaccgcagaaggccagtaaatccccgttgccgccggtcgcggtgttcagcggc
agcagtaagcgacagctgacggctcagggcagtggcacttacagctggcaattgcagact
gaaaagggcaaacagcacagcggtgagttaaccgccggggagccttttacgctgccggga
ccgttgacccagggttatcaccagctgacgctcactaaaggaaagaaaagctggcagacg
cgggttatcgtcgcaccgcgccgctgctatctgcctccggcgctggaggccggagaaaaa
cgctggggtgcactggttcagctttataccgtgcgctctgaacagaactggggcatcggc
gacttcggcgatctcgatcaactgctggtgcagctggctgaacgcggcggcgatttcgtc
gggctgaatccgctgcatgcgctctatcccgccagcgccggttttgccagcccgtatagt
ccgtcatcgcgccgctggctgaacgtaatctatatcgacgtcagtcaggtgaccgatttt
cagcaaagcgcggcggcgcagaaatggtggaaaagcgcgaaaacacagaaggcgctgacc
aaagcacgtgaggcggagcaggttgaatacgaagccgtgatggcgctgaagctggcggcg
ctgcgccatgcctggacacactttcaggcgcgtgacagccagagcgaagagcctctctcc
tttgctgcttttgtgcgtgacggcggtgacagcctgcgctatcaggctgcctacgatggc
atacagctggagcggcaggcagacaagtcgcagcaaggcggctggcctgcctggccagag
gcgtggcgcaacagtcagtcgccggaagtgcagcagtggtgtgaacagcatgaacaggag
atcgccttctggcagtggctgcaatggctggcgcagcagcagttctcaggctgctgggcg
cacagtcaggcgctgggcatgagcgtcggtctctaccgtgacctggcggtgggcgtggcg
gaaggcagtgcggagacctggcacgacccggagctttatcgcctcaaggcctcggtgggc
gcaccgcctgaccgtctgggaccgctgggacaaaactggggcttaccgccgatggatccg
catgtgatgcaggcgcgcgcctatcagccatttatcgacatgctgcgcgccaatatgcgt
gactgtggcgcgctgcgtatcgaccatgtgatgtcgctgctgcgtctgtggtgggtgcca
gccggagagacggcggataaaggtgcttatgtggcctatccggtcaacgatctgctggct
attctgtcgctggagagccaccggctgcgctgtatggtgattggcgaagacctcggcacc
gtgcctcaggagatcgtcagcctgctgcgtaaaagcggcgtcttttcatggaaggtgctg
tggtttgagcaggagaaagatgagcgctatcgcgcccctgaagactatccacgtcagtct
atcgccagcgccagtacccatgatctgccgacgctgaccggcttctgggagcagggcgat
ctggaactgggcgagaagctgggtctttatccgggcgatgcggtaaaagcgttacatgag
cagcgtgccgcacagaagcaggcgctgctggatgcgctgcatcaggcgggtgccttaccg
gctcgcagccagaagaaggcggagaagctggctatgacgcctgcgctgaaccgggcgatc
catcgcttcctggcggataccgacagtgcgctgctggggctacaaccggaggactggctc
ggaatgaccacgccggttaacgtgccgggtacggtggatcagtaccctaactggcggcgc
aagctgagcaaaacgctggaggagatttttgcggacaaggaagtgaatgcgttactgaag
gtcgtgagtcagcagcgtcagtcaggaaagaaagagaagtaa

DBGET integrated database retrieval system