KEGG   Pantoea vagans: Pvag_3159Help
Entry
Pvag_3159         CDS       T01326                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pva  Pantoea vagans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pvag_3159 (tpiA)
   01230 Biosynthesis of amino acids
    Pvag_3159 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_3159 (tpiA)
   00051 Fructose and mannose metabolism
    Pvag_3159 (tpiA)
   00562 Inositol phosphate metabolism
    Pvag_3159 (tpiA)
Enzymes [BR:pva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pvag_3159 (tpiA)
Exosome [BR:pva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pvag_3159 (tpiA)
  Exosomal proteins of bladder cancer cells
   Pvag_3159 (tpiA)
  Exosomal proteins of melanoma cells
   Pvag_3159 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3336878..3337645
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKQITAELIAGLRKELSGVEGCGVAIAPPALYLEQAKHAISGSHIA
LGAQNVDVNLSGAFTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKYAVLKSVG
LVPVLCIGETEAENEAGKTEEVCARQLDAVLETQGAEAFKDAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAIAEQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKSA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccactggttatgggtaactggaagttgaatggcagcaagcagatcacagct
gaactgatcgccggtctgcgcaaggaactctctggcgttgaaggttgtggcgtcgccatt
gcaccgccagcgctctatctcgagcaggcaaaacacgccatctccggtagccacatcgca
ctgggtgcgcagaacgtagacgttaacctgtctggcgcgtttaccggtgaagtttccgct
gaaatgctgaaagatatcggcgcgaaatatatcattatcggtcactcagaacgccgcact
taccacaaagagagcgacgagttcatcgcgaagaaatacgcggtactgaagtcagtgggc
ctggtcccggtgctgtgcattggtgaaaccgaagcagaaaacgaagcgggtaaaaccgaa
gaagtctgcgcgcgtcagctggatgccgttctggaaactcagggcgctgaagcgttcaaa
gatgcggttatcgcgtatgagcccgtctgggccatcggtaccggcaaatctgcgacccct
gctcaggcacaggccgtccacaaattcatccgtgatcatatcgcgaagaaagatgcggct
atcgcagaacaggtcatcattcagtacggcggctcggttaacgataagaatgctgctgag
ctgttcacccagcctgacatcgatggcgcgctggttggcggtgcgtcactgaaagcagat
gctttcgcggtaatcgttaaagctgcggcggctgcaaaaagcgcttaa

DBGET integrated database retrieval system