KEGG   Pantoea vagans: Pvag_3162Help
Entry
Pvag_3162         CDS       T01326                                 

Gene name
pfka3
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pva  Pantoea vagans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pvag_3162 (pfka3)
   01230 Biosynthesis of amino acids
    Pvag_3162 (pfka3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_3162 (pfka3)
   00030 Pentose phosphate pathway
    Pvag_3162 (pfka3)
   00051 Fructose and mannose metabolism
    Pvag_3162 (pfka3)
   00052 Galactose metabolism
    Pvag_3162 (pfka3)
  Energy metabolism
   00680 Methane metabolism
    Pvag_3162 (pfka3)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pvag_3162 (pfka3)
Protein phosphatases and associated proteins [BR:pva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pvag_3162 (pfka3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3339742..3340704)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALSEGLEVFGIYDGYLGLYEDRMINLDRYSVSD
MINRGGTFLGSARFPEFRNEDVRQVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEFPYTREELVAEIKAGIAKGKKHAIVAITEHICDIDDLARFIETETK
RETRSTVLGHIQRGGAPCAYDRILASRMGAYSIELLMQGYGGRCVGIQNEKMVHHDIVDA
IENMKRPFKRDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattggtgtattaaccagcggcggtgacgccccaggcatgaacgcagct
attcgtggagtggttcgttccgcgctgagtgaaggactggaagtttttgggatctatgac
ggttatctgggattgtacgaagatcgcatgatcaatcttgatcgctacagcgtctccgac
atgattaaccgtggcggcacattcctgggctcagcgcgtttccctgagttccgtaatgaa
gatgtgcgccaggttgccattgagaacatgaaaaagcgcggcatcgatgcgctggttgta
attggtggcgatggttcttacatgggtgctaagcgcctgactgaaatgggcttcccctgc
atcggtctgccaggcaccatcgataatgacgtggccggaacggattacaccatcggttat
ttcactgcgctggaaaccgtggttgaagcgattgaccgcctgcgtgatacctcttcttcg
catcagcgtatttcgattgttgaagtgatgggccgctattgtggtgatctgaccctggcg
gcggcgattgccggtggctgtgagttcatcgtcctgccagagttcccgtatacccgcgaa
gagctggttgcggaaatcaaagcgggcatcgccaaaggtaaaaagcacgctatcgtggcg
attaccgagcacatctgcgatatcgacgatctggcgcgtttcattgaaacagagaccaaa
cgtgaaacccgttcgaccgttctgggccatattcagcgtggtggtgcaccttgtgcttat
gaccgtatcctggcgtcacgcatgggcgcttactccattgaactgctgatgcagggttac
ggcggccgttgcgtcggtattcagaacgagaagatggtacatcacgatatcgtcgacgcc
attgaaaacatgaagcgtccattcaagcgcgactggctggacacagcgaaaaaactctat
taa

DBGET integrated database retrieval system