KEGG   Pantoea vagans: Pvag_3240Help
Entry
Pvag_3240         CDS       T01326                                 

Gene name
rbsk3
Definition
ribokinase, rbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pva  Pantoea vagans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pvag_3240 (rbsk3)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pvag_3240 (rbsk3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3421330..3422259)
Genome map
AA seq 309 aa AA seqDB search
MSKNAKLAVLGSINADHILNLAHFPRPGETVIGQNYQVAFGGKGANQAVAAGRAGADIAF
IGCVGADDIGERIREQLAQDNIDTTPVEVVEGESTGVAMIFVNGDGENNIGIYSGANAAL
TPDCVARHQQVIASADALLMQLESPLESVLAAATFARQHQTQVILNPAPATPLSDELLAL
IDIITPNETEAESLTGIAVNNDEDAARAAAALHAKGIGTVLITLGRRGVWLSEQGDGQRI
AGFSVKAIDTIAAGDTFNGAFITARLEQKPMYDAVRFAHAAAAIAVTRSGAQPSVPWRAE
IDEFLQQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaacgcaaaactggccgttcttggcagcattaatgctgaccacatccttaat
ctggcgcacttccctcgtcccggtgaaacggtgatcgggcagaattatcaggttgcgttt
ggcggtaaaggcgcgaatcaggcggtcgccgcgggtcgtgcgggtgccgatatcgccttt
attggctgtgtgggcgctgacgacattggcgaacgtattcgtgagcagctcgcgcaggac
aatattgataccacgcccgtagaagtggttgagggcgagtcgaccggtgtggcgatgatt
ttcgtcaacggtgacggtgagaacaatattggtatctactccggagcaaatgcggcctta
acacccgattgcgtggcgcgtcatcagcaggttattgccagtgccgatgcactcttaatg
cagctggaatcgccgctggagagcgtgctggccgccgcgaccttcgcccggcagcatcag
acgcaggttattctcaatccggcacccgctacccctctctccgatgagctgctggcgctg
attgatattattaccccgaatgagaccgaagcagagagtctgaccggtattgcggttaac
aatgatgaagatgcggcccgcgcggcggcagcactgcatgcgaaaggcatcggcacggta
ctgattacgctgggacgccgcggtgtctggctgagcgagcagggagacggtcagcgtatt
gcgggcttcagcgttaaagctattgataccatcgccgcaggcgacacctttaacggtgcc
tttattacggcacgactggagcagaagccgatgtatgacgcggtgcgatttgcccatgcc
gccgccgcgattgccgttacgcgttcaggtgcacagccctccgtgccgtggcgcgcggag
atcgatgaatttttgcagcagcagggttaa

DBGET integrated database retrieval system