KEGG   Pantoea vagans: Pvag_3358Help
Entry
Pvag_3358         CDS       T01326                                 

Gene name
yhjM
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pva  Pantoea vagans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pvag_3358 (yhjM)
Enzymes [BR:pva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pvag_3358 (yhjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3555994..3557001
Genome map
AA seq 335 aa AA seqDB search
MKRKPFWMGWICTVLLLACSAQANASGWDTFKSRFLTAEGRITDTANNNVSHTEGQGYGM
LLAVANNDRATFDRLWQWTRTQLRNPQTDLFYWRYVPGSDNPVADKNNASDGDVLLAWAL
QRAAQKWQVESYQQESDRIQRAIIKLDVTSFGGHTVLLPGAQGFNKTSYVVLNPSYFLFQ
AWREFGERSHLQVWDKLINDGFDLLGKLSFGKTGLPLDWVALNADGSVAPAVGYSNRFSY
DAIRVPLNIWWYDPHSLALVPFQRVWQGYSRMLTPAWFDVLANAPAPYHLEGGLLAVRDL
TLNETGYLSDKLAADQNYFSASLQLLTWQAFQEKR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaagccattctggatgggctggatctgcactgttttactgctggcctgcagc
gcgcaggccaatgccagcggctgggatacctttaaaagtcgttttctgaccgccgaaggg
cggatcacggataccgccaataacaatgtcagtcacaccgaaggtcaggggtatggcatg
ttgctggcggtggccaacaacgatcgcgccacctttgatcggctgtggcagtggacacgc
actcagctgcgtaatccgcagaccgatctcttctactggcgctatgtgccgggcagtgac
aacccggttgccgacaaaaataacgcctcggatggcgatgtgctgctggcatgggcgctg
caacgcgccgcacagaaatggcaggtggagagttaccagcaggagtcagaccgcattcag
cgcgcgatcatcaagctggatgtcacgagcttcggcggccataccgtcctgctgccgggc
gcgcagggcttcaataaaaccagctatgtggtgctgaatccttcgtacttcctgtttcag
gcgtggcgggagtttggcgagcgcagtcatctgcaggtctgggataagctgattaacgat
ggttttgatctgctgggtaagctgagctttggtaaaaccggcctgccgctggactgggtc
gcgctgaatgcggatgggtcggttgcgccagcggtgggttactcaaaccgcttcagctac
gacgcgatccgcgtgccgctgaacatctggtggtacgatccgcacagtctggcgctggtg
ccgtttcagcgcgtctggcagggttacagccgcatgctgacccccgcctggttcgatgtg
ctggcgaatgcaccagccccttaccatcttgagggcggtctgctggcggtgcgtgacctg
acgctgaatgagaccggctatctgagcgataagctggctgccgatcagaactacttctct
gccagcctgcagttgctgacctggcaggcatttcaggagaagcgctaa

DBGET integrated database retrieval system