KEGG   Pantoea vagans: Pvag_3419Help
Entry
Pvag_3419         CDS       T01326                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pva  Pantoea vagans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pvag_3419 (pldB)
Enzymes [BR:pva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pvag_3419 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3624758..3625750
Genome map
AA seq 330 aa AA seqDB search
MNQHKASWLRREKAFAAFATGPLLDFWHRREELEFTGVGNLTLRYVRFTSPQHKRVILIV
PGRIESYIKYPELAYDLFHCGFDVVILDHRGQGRSDRLLEDSHRGHVAEFTHYVDDLETL
YLKEIVSGHYQQRYALAHSMGGAILTLFLARQPQAFHAVALVAPMFGIALPLPSFLAHRI
LDWAEKRPALRDGYALGTGRWRAHPFGINRLTHSAERYRRNLRFYADDPAIRVGGPTYHW
VREGIHAGRNIISQVDKITTPLLLLQASDDRVVDNRSQDLFCAAMVAAGHPCEGNQPRVI
DGARHEILFEKDEMRAEALNAVVDFFSSHH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacacaaagccagctggctgcgacgggaaaaagcctttgctgccttcgccacc
gggccgctgctcgatttctggcaccgtcgggaggagcttgagtttaccggcgtcggcaat
ctgacgctgcgttatgttcgcttcacatcgccgcaacacaagcgtgtgatcctgattgtg
ccgggacgcatcgagagttacataaaatatcctgagctggcgtacgatctgtttcactgc
ggatttgatgtggtgatcctggaccatcgcggtcaggggcgttccgatcgcctgctggaa
gattcacaccgcggtcacgtggcagaattcacgcattacgttgacgatcttgaaacgctc
tatctgaaagagatcgtcagcggccattaccagcagcgctatgcgctggctcactcaatg
ggtggcgcaattttaacgctgtttctggcgcgtcagccgcaggcgtttcatgcggtcgcg
ctggtggcaccgatgtttggcatcgccttaccgttgccctcttttctggctcatcgtatc
ctggactgggcggagaaacgtccagccttacgcgatggctatgcgctcggcaccggacgc
tggcgcgcgcatccgtttggcattaaccggctgacccatagcgccgagcgttaccggcgt
aacctgcgtttttatgcggacgatccggcgattcgtgtgggcggaccgacctaccattgg
gtacgcgaaggcatccatgcggggcgcaacatcatcagtcaggtggataagatcactacg
ccgctgctgctgttacaggccagcgacgatcgggtggtcgacaatcgttcgcaggacctg
ttttgtgccgcgatggtggcggcgggtcatccgtgtgaaggtaatcagccacgggtgatc
gatggcgcgcgtcacgagatcctgtttgaaaaagatgagatgcgtgccgaagcactcaat
gcagtggtcgactttttttcatcgcaccactga

  All links  
No link information was found.   
DBGET integrated database retrieval system