KEGG   Pantoea vagans: Pvag_3442Help
Entry
Pvag_3442         CDS       T01326                                 

Gene name
fadB
Definition
enoyl-CoA hydratase / dodecenoyl-CoA delta-isomerase / 3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA epimerase (EC:5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pva  Pantoea vagans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pvag_3442 (fadB)
   01212 Fatty acid metabolism
    Pvag_3442 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pvag_3442 (fadB)
   00650 Butanoate metabolism
    Pvag_3442 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Pvag_3442 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Pvag_3442 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pvag_3442 (fadB)
   00310 Lysine degradation
    Pvag_3442 (fadB)
   00380 Tryptophan metabolism
    Pvag_3442 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pvag_3442 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pvag_3442 (fadB)
   00281 Geraniol degradation
    Pvag_3442 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Pvag_3442 (fadB)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pvag_3442 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pvag_3442 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pvag_3442 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Pvag_3442 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3649220..3651403)
Genome map
AA seq 727 aa AA seqDB search
MLYQGANLTLHWLDDGIAELVFDATGSVNKLDTQTVASLGEAIAVLEQQPDLRGLLLSSA
KPAFIVGADITEFLSLFDAPTEKLSQWLSYANSIFNRLEDLPVPTLAAIDGYALGGGCEC
VLATDLRIATADARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVDGNAALK
LGLVDAVVVREKLREAGITMLKAAAADDSWRARRAPKLAPLKLSPIEAAMSFTIAKAMVL
QTAGKHYPAPLMAVKTIEAAASLGRDDALKLETAAFVPLAQSDEARALVGIFLNDQYVKS
LAKKRGSESGAPAQAAVLGAGIMGGGISYQSAWKGVPVRMKDINPQALTLGMNEASKLLN
KLLERGKIDGSKLASVIATIQPTLDYAGFDQADVVVEAVVENPLIKAKVLAETEQHLRQD
AILASNTSTIPISQLAQALQRPENFCGMHFFNPVPRMPLVEVVRGEKTSEATLSKVVAWA
SKMGKTPIVVNDCPGFFVNRVLFPYFAAFSLLLRDGADFRQIDKVMEKQFGWPMGPSWLL
DVVGIDTAHHAQSVMADGFPDRMKHDYRDAIDLLFDAGRFGQKNGKGFWRWEEDKKGKLK
KVPDAEVDTLLQQVCQPARVFSDEEILNRMMLPMLNEVVRCLEEKIIASPAEADMALVYG
LGFPPFRGGAFRYLDTLGNSNVVDQARRYSALGGLYALPALLVQKAHQHESWYPAAKPID
EAALKSA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgctaaccttactcttcactggctggacgatggcatcgccgagctg
gtttttgacgctacaggctcggtcaataagctcgatacgcaaacggtcgccagtctgggc
gaggcgattgcggtgctggaacagcagccagacctgcgcggcctgctgctgagctccgct
aaacctgcttttattgtgggcgcggatatcaccgagttcctttctttgtttgatgcaccc
accgaaaaactgagtcagtggctgagctacgccaacagcatcttcaaccgtcttgaagat
ttaccggtgccaaccctggccgccattgacggctatgcgctgggtggcggatgcgaatgc
gtactggcaaccgatctgcgtatcgccactgcggatgcccgtattggcctgccggaaaca
aaacttggcatcatgcccggctttggtggcagcgtgcgattgccgcgcctgctgggtgcc
gacagtgcgctggaaattattgcagcgggtaaagatgtggatggcaatgccgccctgaaa
ctcggtctggtcgatgcggtcgtggtgcgtgagaaacttcgcgaggcggggatcaccatg
cttaaggccgctgccgcagatgacagctggcgcgcacgccgggcaccgaaactggcaccg
ctgaaactcagcccgattgaagcggcgatgagcttcacgattgcgaaagcgatggtgctg
cagaccgcaggtaaacactatcccgctccgctaatggccgtaaaaacaattgaagcggca
gccagcctgggtcgtgatgatgcgctgaaacttgaaacggcagcgtttgtgccgctggcg
cagtctgatgaagcccgcgcactggtcggcatcttcctcaacgaccagtacgttaaaagc
ctggcgaaaaaacgcggcagcgaaagcggcgctccggctcaggcagcggtactgggcgcg
ggaattatgggtggcggcatcagctaccagtctgcctggaaaggcgtgccagtcagaatg
aaagacattaatccgcaggcgttaacgctggggatgaatgaagccagcaagctgctcaat
aagctgctggagcgcggcaaaatcgacggcagtaaactcgccagtgtgatcgccactatt
caacccaccctggattacgccggttttgaccaggccgatgtggtggtggaagccgtggtc
gagaacccgctgatcaaggccaaagtgctggctgaaaccgaacagcatctgcgtcaggat
gcgattctggcttccaatacctcaaccattcctatcagccagctggcacaggcgctgcag
cgcccggaaaatttctgtggcatgcacttcttcaatccggtgccgcgtatgccgctggtt
gaagtggttcgtggcgagaaaaccagtgaagcgacactgagtaaagtggtggcatgggcc
agcaaaatgggcaaaacgcctatcgtggtgaatgactgccccggcttctttgtgaaccgg
gtgctgttcccctacttcgccgctttcagcctgctgctgcgcgacggcgctgatttccgt
cagattgataaagtgatggaaaaacagttcggctggccgatggggccgtcatggctgctg
gatgtggtgggcatcgataccgcgcaccacgcgcaaagcgttatggcggatggttttccg
gatcgcatgaagcacgactatcgcgatgcgatagacctgctgtttgatgccggtcgtttt
ggtcagaaaaatggcaaaggcttctggcgctgggaagaggataaaaagggcaagctgaag
aaagtgccggatgctgaagtggatacgctgctgcaacaggtctgtcagcccgcgcgggtc
ttcagtgatgaagagatcctgaaccgtatgatgctgccgatgctgaatgaagtcgtgcgc
tgcctggaagagaagattatcgcttcgccagcagaagcagatatggcgctggtctatggc
ctcggcttcccgccgttccgtggtggtgctttccgctacctcgataccctgggcaacagc
aatgtggtcgatcaggcccggcgctacagcgcgcttggtggcctgtatgccctgcctgcg
ctgctggtgcagaaagcccatcagcatgaaagctggtatcccgccgccaaaccgattgat
gaagccgcgctgaaaagcgcctga

DBGET integrated database retrieval system