KEGG   Pantoea vagans: Pvag_3488Help
Entry
Pvag_3488         CDS       T01326                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pva  Pantoea vagans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pvag_3488 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pvag_3488 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    Pvag_3488 (aceB)
Enzymes [BR:pva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pvag_3488 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3699276..3700874
Genome map
AA seq 532 aa AA seqDB search
MTDSVISHTLSFSQPLNHAEQQLLTLEAVSFLEALVARFAPQRDVLLSDRQQRQQQYDQG
YLPDFDMETASIRASEWRIQSIPADLEDRRVEITGPPERKMVINALNANVKVFMADFEDS
LSPEWSKLIDGQLTLREAVQGTLSYTSDTGKIYQLGANPAVLMCRVRGLHLSEKHVSWQG
EAIPGGLFDFALYFFHNVRPLLAKGSGPYFYLPKTESWQEIAWWREIFSFSEDQFDLPRG
TIKATVLIETLPAVFQMDEILWNLRDHIVGLNCGRWDYIFSYIKTLKQHPDRVLPDRQSV
TMSQPFLDAYSRLLIKTCHRRGAFAMGGMSALIPAKDPTRNAWVLQRVTEDKQREAGNGH
DGTWIAHPGLADTAMAVFDAVLDDRPNQLHVMREEDAPITAEQLLAPCQGERTEAGMRAN
IRVALQYLEAWISGNGCVPIDGLMEDAATAEIARTSIWQWIRHQQMLNSGQRVTAELFLR
WLNEELHLLQNALGEARFSAGRYDDAAQLMAQITTERELVSFLTLPGYRLIP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacagactcagtgatcagccataccctctctttcagccagcccttaaaccatgccgaa
cagcagttattaaccctcgaggccgtctcttttctggaggcgctggttgcgcgctttgca
ccgcaacgcgacgtgctgttatcagatcgccagcagcgtcagcagcaatatgaccagggc
tatctgccagacttcgatatggaaaccgcttccataagagccagcgaatggcgtattcaa
tccattccggcagacttagaagatcgtcgggtcgagatcacggggccacccgagcgaaaa
atggtgattaatgccctgaacgcaaacgtaaaagtttttatggccgactttgaggattcg
ctgtcaccggagtggtcaaaactgattgacgggcagctgacactgcgcgaagcggtgcag
ggcaccctgagttacaccagcgacacgggcaaaatttatcagctcggcgctaatccagcg
gtgctgatgtgccgggttcgcggcctgcatctgtcagaaaaacatgtcagctggcagggt
gaggcgattccgggcgggctgtttgatttcgcactctatttcttccacaacgtccggcct
ttgctggctaagggcagcggaccttacttctatctgcctaagaccgagagctggcaggag
atcgcatggtggcgtgagatcttcagcttcagcgaggatcagttcgatctgccgcgcggc
acgatcaaagcaacagtgctgattgaaaccttacccgccgtgtttcagatggatgagatc
ctgtggaatctgcgcgatcacatcgttggactcaactgtggccgctgggattacatcttc
agctacatcaaaaccctgaaacagcatccggatcgcgtactaccggatcgccagtccgtc
accatgtctcagccgtttctggatgcttactcgcgtctgctgattaaaacctgtcatcgc
cggggagcattcgcgatgggcggtatgtcagcgctgatccccgctaaagatccgacgcgc
aatgcctgggtgctgcagcgcgtgacggaagataaacaacgggaggcgggcaacgggcat
gacggcacatggattgcgcatccgggcctggcagataccgctatggcggtcttcgatgct
gtgctggacgaccggccgaatcagctgcatgtcatgcgtgaagaagatgccccgatcacg
gcggagcaattactcgcaccctgtcagggtgagcgcaccgaagcggggatgcgcgccaac
atccgcgtcgccctgcaataccttgaagcctggatcagcggtaacggctgtgtgccgatt
gacgggctgatggaggatgccgctaccgctgagattgcacgcacctcaatctggcaatgg
attcgtcaccagcaaatgctgaacagtggccagcgggtcacggccgaactgtttctgcgc
tggctgaacgaagagctgcatctgctgcaaaacgcgctgggtgaagcccgctttagtgcc
ggtcgctatgatgacgcggcgcagctgatggcgcagatcaccaccgagcgcgagctggtt
tcctttcttaccctgccaggctaccgcctgatcccctga

DBGET integrated database retrieval system