KEGG   Pantoea vagans C9-1: Pvag_3489Help
Entry
Pvag_3489         CDS       T01326                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00630  Glyoxylate and dicarboxylate metabolism
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01120  Microbial metabolism in diverse environments
pva01200  Carbon metabolism
Module
pva_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pvag_3489 (aceA)
Enzymes [BR:pva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pvag_3489 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ADO11608
UniProt: E1SAU4
Position
3700892..3702193
Genome map
AA seq 433 aa AA seqDB search
MTRTQQIDQLEQLWQTARWEGITRPYSAAEVVNLRGSVLPACTLAERGAEKLWALLNGEA
KKGYINSLGALSGGQALQQAKAGIEAIYLSGWQVAADANVAGQMYPDQSLYPVNSVPEVV
TRINQTFQRADQIQWSSGIEKGDSRYTDFFLPIVADAEAGFGGVLNAYELMKAMIQAGAA
AVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTVLLARTDADAADLI
TSDCDEYDRPFIRGDRTAEGFFRTHAGIEQAISRGLAYAPYADILWCETSTPDLAMAQRF
ADAIHARFPGKLLAYNCSPSFNWKKNLDDRTIAKFQQALSDMGYRFQFITLAGIHSMWFN
MFDLAHAYAQGEGMRHYVEKVQQPEFAARDRGYSFSSHQQEVGTGYFDQVTNIIQGGKSS
VTALTGSTEEHQF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtactcaacagatcgatcaactggaacaactctggcagaccgcacgctgggag
ggcattacccgtccttatagcgccgcagaggtcgtcaatctgcgcggctcggtcctgccc
gcctgtacgctggcagagcgcggtgcggagaagttatgggcgctgctgaacggcgaagcg
aagaaagggtatatcaacagtctgggggcgctcagcggcgggcaggcactgcagcaggcc
aaagcgggcattgaagcaatttacctttctggctggcaggtggctgcggatgccaacgta
gcggggcagatgtatcccgatcagtcgctttacccggtgaactcggtgccggaagtggtg
acgcgcatcaatcagacctttcagcgcgccgatcagattcagtggtccagcggtatcgaa
aagggtgacagccgatacaccgatttctttctgccgattgtcgctgatgcggaagccggt
tttggcggcgtactcaatgcgtatgagctgatgaaggcgatgattcaggcgggcgcggct
gcggttcacttcgaagatcagctggcggcggtaaaaaaatgcggtcacatgggtggcaaa
gtgctggtaccgactcaggaagcgattcagaaactggtggcggcgcggctggctgcggat
gtcatgggcgtgccaacggtactgctggcccgcaccgatgccgacgccgcggacctgatt
acctcagactgcgatgaatacgatcgtccttttatccgtggcgaccggacggcagaaggc
ttcttccgcacccacgctggcattgaacaggcgatcagtcgcgggctggcttatgcccct
tatgctgacatcctgtggtgtgaaacctcaacgccggatctggcgatggcgcagcgcttt
gccgatgccatccatgcgcgcttccccggcaaactgctggcctacaactgctcgccatcg
ttcaactggaagaagaacctcgacgaccgcaccatcgcgaagttccagcaggcgctcagc
gacatgggctatcgcttccagttcatcacgctggcgggcatccacagcatgtggttcaac
atgttcgatctggcgcatgcctatgcccagggcgaaggcatgcgtcactacgtggaaaag
gtgcagcagcctgagttcgccgcccgcgatcgcggttacagcttctcgtcacatcagcag
gaagtgggcaccggctatttcgatcaggtgaccaacatcattcagggcggtaagtcttcg
gtcaccgcgctcaccggttcgaccgaagagcatcagttctga

DBGET integrated database retrieval system