KEGG   Pantoea vagans: Pvag_3489Help
Entry
Pvag_3489         CDS       T01326                                 

Gene name
aceA
Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pva  Pantoea vagans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pvag_3489 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pvag_3489 (aceA)
Enzymes [BR:pva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pvag_3489 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3700892..3702193
Genome map
AA seq 433 aa AA seqDB search
MTRTQQIDQLEQLWQTARWEGITRPYSAAEVVNLRGSVLPACTLAERGAEKLWALLNGEA
KKGYINSLGALSGGQALQQAKAGIEAIYLSGWQVAADANVAGQMYPDQSLYPVNSVPEVV
TRINQTFQRADQIQWSSGIEKGDSRYTDFFLPIVADAEAGFGGVLNAYELMKAMIQAGAA
AVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTVLLARTDADAADLI
TSDCDEYDRPFIRGDRTAEGFFRTHAGIEQAISRGLAYAPYADILWCETSTPDLAMAQRF
ADAIHARFPGKLLAYNCSPSFNWKKNLDDRTIAKFQQALSDMGYRFQFITLAGIHSMWFN
MFDLAHAYAQGEGMRHYVEKVQQPEFAARDRGYSFSSHQQEVGTGYFDQVTNIIQGGKSS
VTALTGSTEEHQF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtactcaacagatcgatcaactggaacaactctggcagaccgcacgctgggag
ggcattacccgtccttatagcgccgcagaggtcgtcaatctgcgcggctcggtcctgccc
gcctgtacgctggcagagcgcggtgcggagaagttatgggcgctgctgaacggcgaagcg
aagaaagggtatatcaacagtctgggggcgctcagcggcgggcaggcactgcagcaggcc
aaagcgggcattgaagcaatttacctttctggctggcaggtggctgcggatgccaacgta
gcggggcagatgtatcccgatcagtcgctttacccggtgaactcggtgccggaagtggtg
acgcgcatcaatcagacctttcagcgcgccgatcagattcagtggtccagcggtatcgaa
aagggtgacagccgatacaccgatttctttctgccgattgtcgctgatgcggaagccggt
tttggcggcgtactcaatgcgtatgagctgatgaaggcgatgattcaggcgggcgcggct
gcggttcacttcgaagatcagctggcggcggtaaaaaaatgcggtcacatgggtggcaaa
gtgctggtaccgactcaggaagcgattcagaaactggtggcggcgcggctggctgcggat
gtcatgggcgtgccaacggtactgctggcccgcaccgatgccgacgccgcggacctgatt
acctcagactgcgatgaatacgatcgtccttttatccgtggcgaccggacggcagaaggc
ttcttccgcacccacgctggcattgaacaggcgatcagtcgcgggctggcttatgcccct
tatgctgacatcctgtggtgtgaaacctcaacgccggatctggcgatggcgcagcgcttt
gccgatgccatccatgcgcgcttccccggcaaactgctggcctacaactgctcgccatcg
ttcaactggaagaagaacctcgacgaccgcaccatcgcgaagttccagcaggcgctcagc
gacatgggctatcgcttccagttcatcacgctggcgggcatccacagcatgtggttcaac
atgttcgatctggcgcatgcctatgcccagggcgaaggcatgcgtcactacgtggaaaag
gtgcagcagcctgagttcgccgcccgcgatcgcggttacagcttctcgtcacatcagcag
gaagtgggcaccggctatttcgatcaggtgaccaacatcattcagggcggtaagtcttcg
gtcaccgcgctcaccggttcgaccgaagagcatcagttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system