KEGG   Pantoea vagans: Pvag_3672Help
Entry
Pvag_3672         CDS       T01326                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pva  Pantoea vagans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pvag_3672 (folP)
Enzymes [BR:pva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Pvag_3672 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3905845..3906684
Genome map
AA seq 279 aa AA seqDB search
MKLFARDSHLDLSFPHVMGILNVTPDSFSDGGKHNALVDALTHTNEMVNAGATIIDVGGE
STRPGADEVSVEEELERVIPVIDAIAQRFEVWISVDTSKADVIREAARVGAHIINDVRSL
SEPGALEAAAATGLPVCLMHMQGEPRTMQQAPVYENILSEVDTYFAQQIARCEAAGMKKE
QLILDPGFGFGKNLSHNYELLAHLSDFHHFGLPLLVGMSRKSMIGQLLNVGPSQRLTGSL
SCAVIAAMQGAQIIRAHDVKETAEAMRVVEATRRAKGTS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtttgcccgtgattcccatctcgatttatcgtttcctcatgtgatgggcatt
ctaaatgtcacgccggactccttttcagatggtggtaaacataacgcgctggtcgatgcg
ctgacgcataccaatgaaatggtcaacgccggcgcaaccattatcgatgtaggcggcgaa
tcaacacgtcctggcgctgatgaggtcagtgtggaggaggagctggagcgggtcattccg
gtgatcgatgccattgcccagcgtttcgaagtctggatttcagtagacacctctaaagcg
gacgtgatccgggaagccgcgcgagtgggtgctcacatcattaacgatgtccgctcactc
tccgaaccgggggcgctggaagccgccgccgcaaccggactgcctgtctgtttaatgcat
atgcagggcgaaccgcgcaccatgcagcaggcaccggtttacgaaaacatcttaagcgaa
gtggacacttacttcgctcagcagattgcgcgttgcgaagcggcgggaatgaaaaaagag
cagctgatactcgacccgggcttcggtttcggtaaaaatctcagccacaattatgaactg
ctggctcatctcagcgattttcaccactttggtctgccactgctggtggggatgtcgcgt
aaatcgatgattggccagttgttaaatgtcggcccgtcacagcgtttaaccggcagcctg
agctgcgcggtgattgctgccatgcagggcgcgcagattattcgcgcccatgacgtaaaa
gagacggccgaagcaatgcgcgtggtcgaagcgacccgaagagcaaaaggaacatcatga

DBGET integrated database retrieval system