KEGG   Pantoea vagans: Pvag_3725Help
Entry
Pvag_3725         CDS       T01326                                 

Gene name
arge3
Definition
acetylornithine deacetylase (EC:3.5.1.16)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pva  Pantoea vagans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pva01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pva00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3965848..3966960)
Genome map
AA seq 370 aa AA seqDB search
MMSQSQTLAQQLLRFDTINPPGNEAACMHFLANWLMEQGFDVTLSSFGENRLNLMASLPG
SQPGPQLAFTGHLDTVPLGNADWQYDPFGEIVGDRLYGRGSSDMKAAVAAFAVACVTNQQ
AILQGSGVVLLITGGEETGCDGARALIDTADLPDIGALIVGEPTANYPVIGHKGALWLRC
ETRGKTAHGAMPELGINAIYLAAEALGKIQHFSPGAPHPLMKQPTINVGRIAGGLNINSV
PDRTHFDVDIRSAPNLQHATIRQQLTTLLGDSVTVTTLVDLPAVLSEDNQAWIHSVYQHC
QALHDAPLTPRIVPYFTDASLLLPALGSPPCIILGPGEPSMAHQTDEYCLLSRLAEAEVL
YGALINDWMR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccaaagccagacgctggcgcagcagctgctgcgctttgacaccattaatcca
ccgggcaatgaagcggcctgcatgcactttctggcgaactggctgatggagcagggcttt
gacgtcaccttgtcctccttcggtgaaaaccgcctgaacctgatggccagtctgcctggc
agtcagcccggaccgcagctggcgtttaccggccatctggataccgtcccgctcggcaat
gctgactggcagtacgatcctttcggtgaaatcgtgggtgacagactttacgggcgcggg
tcgagtgacatgaaggccgctgtcgcggcgtttgctgttgcctgcgtgacgaatcagcag
gcgattctgcagggttccggcgtagtgctgttgatcaccggtggggaggaaacgggctgt
gacggcgcgcgggcgctgattgataccgctgacctgcccgatattggcgcattgattgtc
ggcgagcctaccgccaactatccggttatcggccacaaaggagcactatggctacgctgt
gaaacccgcgggaaaacagcccatggcgcaatgccggaactgggcatcaatgccatttat
ctggcggcggaggcactgggaaagattcagcacttctcacctggcgcaccccatccgctg
atgaagcagccgaccattaacgtcggacgcattgcaggcggcctgaacattaactcggtg
cccgatcgcacacattttgacgtggatatccgcagcgcacccaatctgcagcacgccacc
attcgtcagcaactgacaaccttactgggagacagcgtaacggtgacgacgctggtggat
ctgccggcggtgctgagcgaagacaatcaggcctggattcattctgtttatcagcattgt
caggcgttacatgacgccccgctgacaccgcgcattgtgccctactttacagatgcgtca
ctgttgttacccgcgctgggttcgccgccctgcattatcctcggtcccggcgagccgtca
atggcgcaccagaccgatgaatactgcctactgagccggttagcggaagcggaagtgttg
tatggtgcgttgattaacgactggatgaggtaa

DBGET integrated database retrieval system