KEGG   Pantoea vagans C9-1: Pvag_pPag30115Help
Entry
Pvag_pPag30115    CDS       T01326                                 

Gene name
ganB
Definition
(GenBank) Putative 1,4-beta-exogalactanase ganB
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pvag_pPag30115 (ganB)
Enzymes [BR:pva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Pvag_pPag30115 (ganB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Cytotoxic Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ADI78183
UniProt: D6YQA1
Position
pPag3:113832..115895
Genome map
AA seq 687 aa AA seqDB search
MNKFPPLSARVNRLLHGADYNPEQWAHQPGIIDDDVAMMKQANCNVMSVGIFSWAKLEPE
EGRYEFGWLDEVIDTLWLQGISVFLATPSGARPAWMSQAYPEVLRVGRDRVHALHGGRHN
HCMTSPVYRQKVQAMNSRLAARYAHHPAVVGWHISNEYGGECHCDRCQQAFRGWLQRRYE
TLEKLNLAWWSDFWSHTYTEWLQIASPAPQGEMSIHGLNLDWRRFMTDQVTDFCREEIKP
LKQANPDLPATTNFMEYFYDYDYWKLATALDFISWDSYPMWHNEKDETTLACYTAMYHDL
MRTLKQGKPFVLMESTPGSTNWQPTSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRTGREVSELGRMLAAMTPVMGSRVEARVAIIFDWESRWAMDNA
QGPRNLGLHYERTVNEHYRAFWEQGVAVDVINGDSDLSGYDLVIAPMLYMVRDGFAARAE
AHVERGGHFVASYWSGIVNESDLCYLGGFPGPLRSLLGIWSEEIDSLTDEECNGVRGVRG
NELGLSGPYQARELCEHIHLEGAMALASYESDFYAGTPAVTVNRVGEGKAWYIASRNDLP
FHRDFYGALIKQLGLPRALATELPPGVVVQRRTDGEKAFLFVQNFTGQAQQLSLPAGLRD
LIDGSGVGGTLMLGPWGCRVLSVLLEQ
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttcccccgctgagcgcccgggttaaccggctgctgcatggtgctgactac
aatccggaacagtgggcgcaccagccgggcattattgatgacgacgtcgcgatgatgaag
caggcgaactgtaacgtgatgtcagtgggtattttcagctgggcgaagctggagccggaa
gaggggcgctatgagtttggctggctggatgaggtgatcgatacgttgtggctgcagggg
atttccgtgtttctcgccacaccgagcggggccaggcctgcctggatgtcgcaggcgtat
ccggaggtgttgcgcgtggggcgcgatcgcgttcatgcactgcacggtggccgtcataac
cactgtatgacctcgccggtttatcgccagaaagtgcaggcgatgaatagccgcctggcc
gcgcgttacgcgcatcatccggcggtggtcggctggcatatctcaaatgagtatggtggt
gagtgtcattgcgatcgctgtcagcaggcctttcgcggctggctgcagcgtcgctatgag
acgctggagaagctgaatctcgcctggtggagtgatttctggagtcatacctacacagag
tggttacagattgcgtcgcctgctccgcagggcgagatgtcgattcatggtctgaatctg
gactggcggcggtttatgaccgatcaggtcactgacttctgtcgggaggagattaagccg
ctgaaacaggcgaatcccgatctgcccgcgaccaccaatttcatggagtatttctacgac
tacgattactggaagctggcaacggcgctggattttatctcctgggacagctacccgatg
tggcacaacgagaaggatgagaccacgctcgcctgttacaccgcgatgtaccacgatttg
atgcgcaccctgaagcagggcaagccgtttgtattgatggaatcgacgccgggctcaacg
aactggcagccgaccagtaagctgaagaagccggggatgcatattctctcttcactgcag
gcagtggcgcatggtgcggacgcggtgcagtatttccagtggcgcaagagtcgggggtcg
gtcgagaagtttcacggtgcggtggtcgatcatgtcggtcatattgatacgcgaaccggg
cgtgaagtgagtgagctgggccggatgctggcagcgatgacgccggtgatgggcagtcgg
gttgaggcgcgcgttgcgattattttcgactgggagagtcgctgggcgatggataatgcg
cagggtccacgcaatctgggtctgcattatgagcgtacggtaaacgagcactaccgtgct
ttctgggaacagggcgttgcggtagatgtgattaacggcgatagcgatctcagcggttac
gatctggtgatagcaccgatgctctatatggtgcgcgacggttttgccgcgcgagcagaa
gcgcatgttgagcggggcgggcatttcgtggccagctactggagcggcatcgtgaatgag
agcgatctctgttatctgggaggattcccgggtccgctgcggtcgctgcttggcatctgg
tcagaagagatcgacagtctgacggatgaggagtgtaacggcgtacgcggggtgcgcggc
aatgagctgggtctgagtgggccatatcaggcgcgggagctttgcgagcatattcatctg
gaaggggccatggcgctggccagttacgagagtgatttttatgccggaaccccggcggtg
acggtgaatcgggtcggtgagggtaaagcctggtatatcgcgtcgcgtaatgatctgccg
ttccatcgggatttttatggtgcgctgattaagcagctgggattgccgcgtgcgctggcg
actgagctgccgccaggcgtggtggtacaacgccgtactgatggtgagaaggcttttctg
tttgtgcagaactttacggggcaggcgcagcagttatcgttgcctgccgggttaagggat
ttaatcgatggctcgggtgtagggggaacgctgatgctggggccgtggggatgtcgggtt
ttgagtgtgcttctggagcaatga

DBGET integrated database retrieval system