KEGG   Pantoea vagans C9-1: Pvag_pPag30130Help
Entry
Pvag_pPag30130    CDS       T01326                                 

Gene name
gpo
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00480  Glutathione metabolism
pva00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pvag_pPag30130 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pvag_pPag30130 (gpo)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pvag_pPag30130 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADI78199
UniProt: D6YQB6
Position
pPag3:complement(125778..126254)
Genome map
AA seq 158 aa AA seqDB search
MSVFYKLTATSLNGQPVPMSDFAGKIVLVVNTASHCGFTPQYAGLETLYKKYADQGLVVL
GFPCNQFGNQEPGGADEIAQTCHINYGVSFPMFGKVNVNGTSTHPIFHYLKDELPGVLGG
RIKWNFTKFLIGRDGKPIKRFAPTTTPEKMEAAILAAL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcttttataaactcacagccaccagcctgaacggccagcctgtaccgatgtcc
gacttcgctggcaagatcgtgctggtcgttaacaccgccagtcactgtggattcacgcca
caatacgccggcctcgaaaccctctacaaaaaatatgccgatcaggggctggtggtactg
ggttttccctgcaatcagtttgggaatcaggaacctggcggagccgacgaaattgcgcag
acatgccacattaactacggggtaagttttccgatgtttggcaaagtgaatgtcaatggc
acctcaacgcacccgatttttcattacctgaaagatgaattacccggcgttttgggtggt
cgtattaagtggaatttcactaagtttctgatcgggcgcgacggtaaaccgattaaacga
tttgcaccaaccaccacgccggagaaaatggaagccgccattcttgctgccctttga

DBGET integrated database retrieval system