KEGG   Pantoea vagans: Pvag_pPag30318Help
Entry
Pvag_pPag30318    CDS       T01326                                 

Gene name
bglB
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pva  Pantoea vagans
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pva00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPag3:complement(318311..319705)
Genome map
AA seq 464 aa AA seqDB search
MKTFPDSFLWGGAVAANQVEGAWREEGKGLSTSDVQPQGIFGPVVERVAGSQSLKDVAID
FYHRYPDDIRLFAEMGFGCLRVSIAWTRIFPNGDEQQPNEAGLAFYDRLFDELAAHNITP
LVTLSHYEMPWNLVKQYGGWGNRQVIGFFEHYARTVFNRYQKKVRLWLTFNEINMSLHAP
MTGVGLPETSSLGEIYQAIHHQLVASALAVKACHEINPDASIGNMLLGGLVYPLSCNPDD
VLEALQENRKWQFFGDVQCRGAYPGYMLRFFRDNNILLDITDTDRQILKSTVDFISFSYY
MSGCITADEALNEKMRGNILSMVPNPHLQSSEWGWQIDPVGLRTLLNLLWDRYQKPLFIV
ENGLGAKDIPDATGVVQDDYRISYLNDHLVQVREAIEDGVDVMGYTSWGPIDLVSASKAE
LSKRYGFIYVDRDDNGEGSLARSRKKSFHWYKEVIATNGASLKE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttcccggattcatttttatggggcggtgctgttgccgctaaccaggttgaa
ggcgcatggcgtgaagaggggaaaggcctttccacctctgacgtccagccacaggggatt
tttggcccggtcgtggagcgcgttgcggggagccagagccttaaagatgtggcgatcgat
ttttaccaccgctacccggacgatatcaggctgtttgcagagatgggcttcggctgtctg
cgggtttcaattgcctggacgcgtattttcccgaacggtgacgagcagcaacccaacgag
gctggcctggccttttatgaccgcttattcgatgagctggcagcgcataacatcactccg
ctcgtgaccctgtcacattatgaaatgccctggaatctggttaagcagtatggtggctgg
ggcaaccgtcaggtaatcggattctttgaacattacgcacgcacggtgtttaaccgttat
cagaagaaagtcaggctctggctgacatttaacgaaattaacatgtctctgcatgcgccg
atgaccggcgtgggtctgccggaaaccagcagcctgggcgaaatttatcaggcgattcac
catcaactggtcgccagtgcgctggcggttaaagcctgtcacgagatcaacccggatgcc
agcatcggcaatatgctgctgggtggtttggtctacccgctaagctgtaaccccgacgat
gtgctggaagcgctgcaggagaaccggaaatggcaattttttggcgatgtgcagtgccgg
ggagcttatccgggctatatgttgcgcttcttccgcgacaacaacattctgctggatatt
acggataccgatcgccagatactcaaatcgaccgtcgattttatctcgttcagctactac
atgtccggctgtattaccgccgatgaggcgctgaatgagaagatgcgcggtaacattctg
agcatggtgcctaatccccatcttcagagctctgaatggggctggcaaattgatccggtc
gggttgcgtaccttgcttaatctgttgtgggatcgttatcaaaagccgctgttcatcgtt
gagaacggactgggtgccaaagacattcctgatgccaccggcgtcgtgcaggatgactac
cgcatcagctacctcaacgatcatctggtgcaggtgcgtgaagcgattgaagatggtgtt
gacgtcatggggtataccagctgggggccgatcgatcttgtgagcgcatctaaagcggaa
ctgtctaaacgctacggttttatttatgtagaccgcgatgacaacggggaaggttcgctg
gcgcgcagccgtaagaaaagcttccactggtataaagaggttattgcaacaaacggggcc
tcactcaaagagtaa

DBGET integrated database retrieval system