KEGG   Pantoea vagans: Pvag_pPag30437Help
Entry
Pvag_pPag30437    CDS       T01326                                 

Gene name
ascB
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pva  Pantoea vagans
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_pPag30437 (ascB)
Enzymes [BR:pva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Pvag_pPag30437 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPag3:432971..434401
Genome map
AA seq 476 aa AA seqDB search
MSDSRFPQGFLWGGALAANQSEGGFREGGKGLTTVDMIPHGPHRLAVKLGLEKRFTLRDD
EFYPSHDAIDFYHRYPEDIALMAEMGFSVFRTSIAWSRLYPNGDELTPNPEGIAFYRAVF
EECRKYNIEPLVTLCHFDVPMHLVTEYGSWRNRKMVDFFARYARSCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLVFEPDENREQVKYQAAHHELVASALVTRIAHEVNPTNQVGCMLA
GGNFYPWSSKPEDVWAALEKDRENLFFIDVQARGAYPAYAARVFREKGVTLEIADGDADI
LKNSVDFVSFSYYASRCASAEMNEQNSSAANVVKSLTNPHVPRSEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGARDEIDANGEINDDYRISYLREHIRAMADAIEDGVPVIGYTS
WGCIDLVAASTGEMSKRYGFVYVDRDDLGNGTLARTRKKSFWWYKKVIASNGADLE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattcaaggttcccgcaagggtttttatggggcggcgcgttagccgccaatcag
agtgaaggcggttttcgtgagggcggaaagggcttaaccaccgtcgatatgatcccgcat
ggcccacaccgactggcggtcaagctgggtctggaaaagcgctttacgctgcgggatgat
gaattttatcccagccatgatgccatcgatttctatcaccgctatccggaagatattgcg
ctgatggcggaaatggggttcagcgtgtttcgcacatcaattgcctggagccgcctctat
cccaatggcgatgaactgacgcccaatccggagggcatcgctttttaccgcgcggtgttt
gaggagtgccggaaatataatatcgaaccgctggttacgctctgtcatttcgatgtgccg
atgcatctggtgaccgaatatggctcatggcgcaatcgtaaaatggtcgacttctttgcc
cgctatgcccgtagctgtttcgaggcgtttgatggcctggtgaaatactggctgaccttc
aacgagatcaacatcctgctgcacagcccgttttccggtgcgggtctggtgttcgaaccg
gatgaaaacagggagcaggtgaagtatcaggcggcacatcacgaactggtcgccagcgcg
ctggtcacgcgaatcgcgcatgaagtcaatccgacgaatcaggtcggctgcatgctggca
ggcggcaacttctatccgtggtccagcaaaccggaagatgtctgggcagcgctggaaaaa
gatcgtgaaaacctgttctttattgatgtccaggcacgcggtgcttatccggcttatgct
gcgcgcgtgttccgtgaaaaaggtgtcacgcttgagatcgctgacggcgatgccgatatc
ctgaaaaacagcgtcgattttgtctcgttcagttattacgcctctcgctgcgcctcggcg
gagatgaacgaacagaacagcagcgcggccaatgtggtgaaatccctgaccaaccctcat
gtgccacgtagcgagtggggctggggcatcgatccactgggcttacgcattaccatgaat
atgatgtacgaccgctatcagaagccgcttttcctggtggaaaatggtctgggcgcgcgc
gatgaaatcgatgcgaatggcgagatcaatgacgactaccgcatcagctatctgcgcgag
catatccgcgccatggccgatgccatagaggatggagtcccggtgatcggctacaccagt
tggggctgtatcgatctggtggccgcttcgaccggtgaaatgagcaagcgctacggtttt
gtctatgttgatcgggacgatcttgggaacggtacgctggcgcgcacgcgaaagaaatcg
ttctggtggtataagaaagtgattgccagtaacggggcagatcttgagtga

DBGET integrated database retrieval system